SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000015639 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000015639
Domain Number 1 Region: 354-817
Classification Level Classification E-value
Superfamily TPR-like 0.00000449
Family BTAD-like 0.081
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000015639
Domain Number - Region: 1055-1104
Classification Level Classification E-value
Superfamily TPR-like 0.0284
Family Tetratricopeptide repeat (TPR) 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000015639   Gene: ENSPANG00000010337   Transcript: ENSPANT00000019601
Sequence length 1147
Comment pep:known_by_projection chromosome:PapAnu2.0:7:146381044:146433959:-1 gene:ENSPANG00000010337 transcript:ENSPANT00000019601 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALFPAFAGISEAPDSGSSRKELDWLSNPSFCVGSITSLSQQTEAAPAHVSEGSPLTRSP
LKSEPSDESDTGKHQHHKKTKRKHGQSSSSRSETDTDSEKDKPSRGVVGSKRQSEKPNQG
NNAAADTGHRFVWLEDIQAVTGETFRTDKKPDPANWEYKSLYRGDIASRYKRKGDSCLGI
NPKKQCISWEGTSTEKKHSRKQVERYFTKKSVGLMNIDGAAISSKTEPPSSEPISFIPVK
DLEDAAPVTTWLNPLGIYDQSTTQWLQGQGPPEQESKQPDTQPDSESAALKAKVEEFNRR
VRENPRDTQLWMAFVDFQDEVMKSPGLYAIEEGEQEKRKRSLKLILEKKLAILERAIESN
QSSVDLKLAKLKLCTEFWEPSTLVKEWQKLIFLHPNNTALWQKYLLFCQSQFSTFSISKI
HSLYGKCLSTLSAVKDGSILSHPALPGTEEAMFALFLQQCHFLRQAGHSEKAVSLFQAMV
DFTFFKPDSVKDLPTKGQVEFFEPFWDSGEPRAGEKGARGWKAWMHQQERGGWVVINPDE
DDDEPEEDDQEIKDKTLPRWQIWLAAERSRDQRHWRPWRPDKTKKQTEEDCEDPERQVLF
DDIGQSLIRLSSHNLQFQLVEAFLQFLGVPSGLTPPASCLYLAMDENSIFDNGLYDEKPL
TFFNPSFSGASCVGRMDRLGCPRWTRGQNREGEEFIRNVFHLVMPLFSGKEKSQLCFSWL
QYEIAKVIWCLHTKNKKRLKSQGKNCKKLAKNLLKEPENRNNFCLWKQYAHLEWLLGNTE
DARKVFDTALGMAGSRELKDFDLCELSLLYAELEVELSLEVRGAATARAVHILTKLTESS
PCGPYTGQVLAVHILKARKAYEHALQDCLGDSCVSDPAPADSCSRLISLAKCFMLFQYLT
TGIDAAVRIYEQVFAKLNSYVFPEGSGKGDSASSQSWTSVLEAITLMHTSLLRFHMKVSV
YPLAPLREALSQALKLYPGNQVLWRSYVQIQNKSHSASKTRRFFDTITRSAKALEPWLFA
IEAEKLRKRLVETVQRLDGREIHATIPETGLTHRIQALFENAMRSDSGSRCPLLWRMYLN
FLVSLGNKERSKGVFYKALQNCPWAKVLYLDAVEYFPDEMQEILDLMTEKELRVRLPLEE
LELLLED
Download sequence
Identical sequences ENSPANP00000015639

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]