SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000015642 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000015642
Domain Number 1 Region: 775-907
Classification Level Classification E-value
Superfamily TPR-like 7.59e-25
Family Tetratricopeptide repeat (TPR) 0.015
Further Details:      
 
Domain Number 2 Region: 507-624
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000000117
Family Tetratricopeptide repeat (TPR) 0.017
Further Details:      
 
Domain Number 3 Region: 379-565
Classification Level Classification E-value
Superfamily TPR-like 0.00000000114
Family Tetratricopeptide repeat (TPR) 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000015642   Gene: ENSPANG00000016352   Transcript: ENSPANT00000021925
Sequence length 923
Comment pep:known_by_projection chromosome:PapAnu2.0:7:146647670:146921562:-1 gene:ENSPANG00000016352 transcript:ENSPANT00000021925 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATKKAGSRLETEIERCRSECQWERIPELVKQLSAKLIANDDMAELLLGESKLEQYLKEH
PLRQGASPRGPKPQLTEVRKHLTAALDRGNLKSEFLQESNLIMAKLNYVEGDYKEALNIY
ARVGLDDLPLTAAPPYRLRVIAEAYATKGLCLEKLPISSSTSNLHVDREQDVITCYEKAG
DIALLYLQEIERVILSNIQNRSPKPGPAPHDQELGFFLETGLQRAHVLYFKNGIDVHEDQ
QNLTRGVGRFRELLRAVETRTTQNLRMTIARQLAEILLRGMCEQSYWNPLEDPPCQSPLD
DPLRKGANTKTYTLTRRARVYSGENIFCPQENTEEALLLLLISESMANRDAVLSRIPEHK
SDRLISLQSASVVYDLLTIALGRRGQYEMLSECLERAMKFAFEEFHLWYQFALSLMAAGK
SARAVKVLKECIRLKPDDATIPLLAAKLCMGSLHWLEEAEKFAKTVVDVGEKTSEFKAKG
YLALGLTYSLQATDASLRGMQEVLQRKALLAFQRAHSLSPTDHQAAFYLALQLAISRQIP
EALGYVRQALQLQGDDANSLHLLALLLSAQKHYHDALNIIDMALSEYPENFILLFSKVKL
QSLCRGPDEALLTCKHMLQIWKSCYNLTNPSDSGRGSSLLDRTIADRRQLNTITLPDFSD
PETVSDSSSSSSPLSRTESPLHLFVSSHLHSHPKPDTFVWPPAAHSFSDAGPRREPSLCN
SPEAYFHGFPSLFSVSSVHATSVAASRVEQALSEVASSLQSSAPKQGPLHPWMTLAQIWL
HAAEVYIGIGKPAEATACTQEAANLFPMSHNVLYMRGQIAELRGSMDEARRWYEEALAIS
PTHVKSMQRLALILHQLGRYSLAEKILRDAVQVNSTAHEVWNGLGEVLQAQGNDAAATEC
FLTALELEASSPAVPFTIIPRVL
Download sequence
Identical sequences ENSPANP00000015642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]