SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000015646 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000015646
Domain Number 1 Region: 229-431
Classification Level Classification E-value
Superfamily TPR-like 2.92e-36
Family Tetratricopeptide repeat (TPR) 0.0047
Further Details:      
 
Domain Number 2 Region: 431-631
Classification Level Classification E-value
Superfamily TPR-like 1.97e-33
Family Tetratricopeptide repeat (TPR) 0.0065
Further Details:      
 
Domain Number 3 Region: 632-829
Classification Level Classification E-value
Superfamily TPR-like 2.69e-33
Family Tetratricopeptide repeat (TPR) 0.0084
Further Details:      
 
Domain Number 4 Region: 33-219
Classification Level Classification E-value
Superfamily TPR-like 4.09e-30
Family Tetratricopeptide repeat (TPR) 0.0052
Further Details:      
 
Domain Number 5 Region: 801-924
Classification Level Classification E-value
Superfamily TPR-like 0.00000347
Family Tetratricopeptide repeat (TPR) 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000015646   Gene: ENSPANG00000009611   Transcript: ENSPANT00000019024
Sequence length 2202
Comment pep:known_by_projection chromosome:PapAnu2.0:10:68530496:68998490:-1 gene:ENSPANG00000009611 transcript:ENSPANT00000019024 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRKLRYLLRENISVGDLVSTSSHFSLYKDWLGAASSALSSLGHVYTAIGDYPNALASHKQ
CVLLAKQSKDELSEARELGNMGAVYIAMGDFENAVQCHEQHLKIAKDLGNKREEARAYSN
LGSAYHYRRNFDKAMSYHNYVLELAQELMEKAIEMRAYAGLGHAARCMQDLERAKQYHEQ
QLGIAEDLKDRAAEGRASSNLGIIHQMKGDYDTALKLHKTHLCIAQELSDYAAQGRAYGN
MGNAYNALGMYDQAVKYHRQELQISMEVNDRASQASTHGNLAVAYQALGAHDRALQHYQN
HLNIARELRDIQSEARALSNLGNFHCSRGEYVQAAPYYEQYLRLAPDLQDMEGEGKVCHN
LGYAHYCLGNYQEAVKYYEQDLALAKDLHDKLSQAKAYCNLGLAFKALLNFSKAEECQKY
LLSLAQSLNNSQAKFRALGNLGDIFICKKDINGAIKFYEQQLGLAHQVKDRRLEASAYAA
LGTAYRMIQKYDKALGYHTQELEVYQELSDLPGECRAHGHLAAVYMALGKYTMAFKCYEE
QLDLGQKLKDPSLEAQVYGNMGITKMNMNVMEEAIGYFEQQLAMLQQLSGNESVLDRGRA
YGNLGDCYEALGDYEEAIKYYEQYLSVAQSLNRMQDQAKAYRGLGNGHRAMGSLQQALVC
FEKRLVVAHELGEAFNKAQAYGELGSLHSQLGNYEQAISCLERQLNIARDMKDRALESDA
ACGLGGVYQQMGEYDTALQYHQLDLQIAEETNNPTCQGRAYGNLGLTYESLGTFERAVVY
QEQHLSIAAQMNDLAAKTVSYSSLGRTHHALQNYSQAVMYLQEGLRLAEQLGRREDEAKI
RHGLGLSLWASGNLEEAQHQLYRASALFETIRHEAQLNTDYKLSLFDLQTSSYQALQRVL
VTLGHHDEALAVAERGRTRAFADLLVERQTGQQDSDPYSPVTIDQILEMVNGQRGLVLYY
SLAAGYLYSWLLAPGAGILKFNEHYLGENTVENSSDFQASSSATLPIATGSALEHHIASV
REALGVESHYSRACASSETESEAGDIMDQQFEEMNNKLNSVTDPTGFLRMVRRNNLFNRS
CQSMTSLFSNTVSPTQDGTSSLPRRQNSFAKPPLRALYDLLIAPMEGGLMHSSGPVGRHR
QLILVLEGELYLIPFALLKGSSSNEYLYERFGLLAVPSIRSLSVQSKSHLRKNPPTYSSS
TSMAAVIGNPKLPSAVMDRWLWGPMPSAEEEAYMVSELLGCQPLVGSVATKERVMSALTQ
AECVHFATHISWKLSALVLTPSMDGNPASSKSSFGHPYTIPESLRVQDDASDGESISDCP
PLQELLLTAADVLDLQLPVKLVVLGSSQESNSKVTADGVIALTRAFLAAGAQCVLVSLWP
VPVAASKMFIHAFYSSLLNGLKASAALGEAMKVVQSSKAFSHPSNWAGFMLIGSDVKLNS
PSSLIGQALTEILQHPERARDALRVLLHLVEKSLQRIQNGQRNAMYTSQQSVENKVGGIP
GWQALLTAVGFRLDPPTSGLPAAVFFPTSDPGDRLQQCSSTLQSLLGLPNPALQALCKLI
TASETGEQLISRAVKNMVGMLHQVLVQLQAGEKEQDLASAPIQVSISVQLWRLPGCHEFL
AALGFDLCEVGQEEVILKTGKQANRRTVHFALQSLLSLFDSTELPKRLSLDSSSSLESLA
SAQSVSNALPLGYQHPPFSPTGADSIASDAISVYSLSSIASSMSFVSKPEGGSEGGGPGG
RQDNDRSKNTYLQRSTLPRSQLPPQTRPAGNKDEEEYEGFSIISNEPLATYQENQNMCFS
PDHKQPRPGTAGGLRVSVSSKGSISTPNSPVKMTLIPSPNSPFQKVGKLASSDTGESDQS
STETDSTVKSQEESNPKLDPQELAQKILEETQSHLIAVERLQRSGGQVSKSNNPEDGVQA
PSSAAVFRASETSAFSRPVLSHQKSQPSPVTVKPKPPARSSSLPKVSSGYSSPTTSETSI
KDSPSQNSGRPSPGSDSQTSQLDQPLFKLKYPSSPYSAHISKSPRNMSPSSGHQSPAGSA
PSPALSYSSAGSARSSPADAPDIDKLKMAAIDEKVQAVHNLKMFWQSTPQHSTGPMKIFR
GAPGTMTSKRDVLSLLNLSPRHNKKEEGVDKLELKELSLQQHEGAPPKAPPNGHWRTETT
SLGALPLPAGPPAAAPARPLRLPSGNGYKFLSPGRFFPSSKC
Download sequence
Identical sequences ENSPANP00000015646

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]