SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000015647 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000015647
Domain Number 1 Region: 422-624
Classification Level Classification E-value
Superfamily TPR-like 9.1e-36
Family Tetratricopeptide repeat (TPR) 0.0047
Further Details:      
 
Domain Number 2 Region: 624-823
Classification Level Classification E-value
Superfamily TPR-like 1.31e-33
Family Tetratricopeptide repeat (TPR) 0.0065
Further Details:      
 
Domain Number 3 Region: 826-1019
Classification Level Classification E-value
Superfamily TPR-like 3.64e-33
Family Tetratricopeptide repeat (TPR) 0.007
Further Details:      
 
Domain Number 4 Region: 226-413
Classification Level Classification E-value
Superfamily TPR-like 5.31e-30
Family Tetratricopeptide repeat (TPR) 0.0052
Further Details:      
 
Domain Number 5 Region: 9-42,145-192,225-253
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000527
Family Tetratricopeptide repeat (TPR) 0.022
Further Details:      
 
Domain Number 6 Region: 994-1117
Classification Level Classification E-value
Superfamily TPR-like 0.00000385
Family Tetratricopeptide repeat (TPR) 0.02
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000015647
Domain Number - Region: 84-181
Classification Level Classification E-value
Superfamily TPR-like 0.00055
Family Tetratricopeptide repeat (TPR) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000015647   Gene: ENSPANG00000009611   Transcript: ENSPANT00000026794
Sequence length 2387
Comment pep:known_by_projection chromosome:PapAnu2.0:10:68530496:68998490:-1 gene:ENSPANG00000009611 transcript:ENSPANT00000026794 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMKWQPRKKAYFRQGVALQYLGRHADALAAFASGLAQDPKSLQLLVGMVEAAMKSPMRDS
LEPTYQQLQKMKLDKSPFVVVSVVGQELLTAGHHGASVVVLEAALKIGTCSLKLRGSVFS
ALSSAYWSLGNTEKSTGYMQQDLDVAKTLGDQTGECRAHGNLGSAFFSKGNYREALTNHR
HQLVLAMKLKDREMRKLRYLLRENISVGDLVSTSSHFSLYKDWLGAASSALSSLGHVYTA
IGDYPNALASHKQCVLLAKQSKDELSEARELGNMGAVYIAMGDFENAVQCHEQHLKIAKD
LGNKREEARAYSNLGSAYHYRRNFDKAMSYHNYVLELAQELMEKAIEMRAYAGLGHAARC
MQDLERAKQYHEQQLGIAEDLKDRAAEGRASSNLGIIHQMKGDYDTALKLHKTHLCIAQE
LSDYAAQGRAYGNMGNAYNALGMYDQAVKYHRQELQISMEVNDRASQASTHGNLAVAYQA
LGAHDRALQHYQNHLNIARELRDIQSEARALSNLGNFHCSRGEYVQAAPYYEQYLRLAPD
LQDMEGEGKVCHNLGYAHYCLGNYQEAVKYYEQDLALAKDLHDKLSQAKAYCNLGLAFKA
LLNFSKAEECQKYLLSLAQSLNNSQAKFRALGNLGDIFICKKDINGAIKFYEQQLGLAHQ
VKDRRLEASAYAALGTAYRMIQKYDKALGYHTQELEVYQELSDLPGECRAHGHLAAVYMA
LGKYTMAFKCYEEQLDLGQKLKDPSLEAQVYGNMGITKMNMNVMEEAIGYFEQQLAMLQQ
LSGNESVLDRGRAYGNLGDCYEALGDYEEAIKYYEQYLSVAQSLNRMQDQAKAYRGLGNG
HRAMGSLQQALVCFEKRLVVAHELGEAFNKAQAYGELGSLHSQLGNYEQAISCLERQLNI
ARDMKDRALESDAACGLGGVYQQMGEYDTALQYHQLDLQIAEETNNPTCQGRAYGNLGLT
YESLGTFERAVVYQEQHLSIAAQMNDLAAKTVSYSSLGRTHHALQNYSQAVMYLQEGLRL
AEQLGRREDEAKIRHGLGLSLWASGNLEEAQHQLYRASALFETIRHEAQLNTDYKLSLFD
LQTSSYQALQRVLVTLGHHDEALAVAERGRTRAFADLLVERQTGQQDSDPYSPVTIDQIL
EMVNGQRGLVLYYSLAAGYLYSWLLAPGAGILKFNEHYLGENTVENSSDFQASSSATLPI
ATGSALEHHIASVREALGVESHYSRACASSETESEAGDIMDQQFEEMNNKLNSVTDPTGF
LRMVRRNNLFNRSCQSMTSLFSNTVSPTQDGTSSLPRRQNSFAKPPLRALYDLLIAPMEG
GLMHSSGPVGRHRQLILVLEGELYLIPFALLKGSSSNEYLYERFGLLAVPSIRSLSVQSK
SHLRKNPPTYSSSTSMAAVIGNPKLPSAVMDRWLWGPMPSAEEEAYMVSELLGCQPLVGS
VATKERVMSALTQAECVHFATHISWKLSALVLTPSMDGNPASSKSSFGHPYTIPESLRVQ
DDASDGESISDCPPLQELLLTAADVLDLQLPVKLVVLGSSQESNSKVTADGVIALTRAFL
AAGAQCVLVSLWPVPVAASKMFIHAFYSSLLNGLKASAALGEAMKVVQSSKAFSHPSNWA
GFMLIGSDVKLNSPSSLIGQALTEILQHPERARDALRVLLHLVEKSLQRIQNGQRNAMYT
SQQSVENKVGGIPGWQALLTAVGFRLDPPTSGLPAAVFFPTSDPGDRLQQCSSTLQSLLG
LPNPALQALCKLITASETGEQLISRLHQVLVQLQAGEKEQDLASAPIQVSISVQLWRLPG
CHEFLAALGFDLCEVGQEEVILKTGKQANRRTVHFALQSLLSLFDSTELPKRLSLDSSSS
LESLASAQSVSNALPLGYQHPPFSPTGADSIASDAISVYSLSSIASSMSFVSKPEGGSEG
GGPGGRQDNDRSKNTYLQRSTLPRSQLPPQTRPAGNKDEEEYEGFSIISNEPLATYQENQ
NMCFSPDHKQPRPGTAGGLRVSVSSKGSISTPNSPVKMTLIPSPNSPFQKVGKLASSDTG
ESDQSSTETDSTVKSQEESNPKLDPQELAQKILEETQSHLIAVERLQRSGGQVSKSNNPE
DGVQAPSSAAVFRASETSAFSRPVLSHQKSQPSPVTVKPKPPARSSSLPKVSSGYSSPTT
SETSIKDSPSQNSGRPSPGSDSQTSQLDQPLFKLKYPSSPYSAHISKSPRNMSPSSGHQS
PAGSAPSPALSYSSAGSARSSPADAPDIDKLKMAAIDEKVQAVHNLKMFWQSTPQHSTGP
MKIFRGAPGTMTSKRDVLSLLNLSPRHNKKEEGVDKLELKELSLQQHEGAPPKAPPNGHW
RTETTSLGALPLPAGPPAAAPARPLRLPSGNGYKFLSPGRFFPSSKC
Download sequence
Identical sequences ENSPANP00000015647

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]