SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000015659 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000015659
Domain Number 1 Region: 355-478
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.000000000000256
Family Synaptotagmin-like (S variant) 0.011
Further Details:      
 
Domain Number 2 Region: 219-349
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00000000000039
Family Synaptotagmin-like (S variant) 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000015659   Gene: ENSPANG00000005140   Transcript: ENSPANT00000016501
Sequence length 521
Comment pep:known_by_projection chromosome:PapAnu2.0:7:147841978:147963264:-1 gene:ENSPANG00000005140 transcript:ENSPANT00000016501 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATEFIKSCCGGCFYGETEKHNFSVERDFKATVPHSQNATISVPPLTSVSVKPQVGCTED
YLLSKLPSDGKEVPFVVPKFKLSYIQPRTQETPSHMEELEASARASFGDRKVELSSSSQH
GPSYDVYNPFYMYQHISPDLSRRFPPRSEVTRLYGSVCDLRTNKLPGSPGLSKSMFDLTS
SSQRFIQRHDSLSSVPSSSSSRKNSQGSNRSLDTITLSGDERDFGRLNVKLFYNSSVEQI
WITVLQCRDLSWPSSYGDTPTVSIKGILTLPKPVHFKSSAKEGSNAIEFMETFVFAIKLQ
SLQTVRLIFKIQTQTPRKKTIGKCSLSLRTLSTQEMDYSLDITPPSKISVCHAELELGTC
FQAVNSRIQLQILEAQYLPSSSTPLTLSFFVKVGMFSSGELIYKKKTRLLKASNGRVKWG
ETMIFPLIQSERDIVFLIKLYSRSSVRRKHFVGQIWISEDSNNIEAVNQWKETVINPEKI
YNWEDLNKTLELREKMVRITMTERRTYKCRGNRFEKHQDVQ
Download sequence
Identical sequences ENSPANP00000015659

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]