SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000015662 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000015662
Domain Number 1 Region: 283-416
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 8.4e-26
Family Synaptotagmin-like (S variant) 0.00044
Further Details:      
 
Domain Number 2 Region: 150-282
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.24e-25
Family Synaptotagmin-like (S variant) 0.000000412
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000015662   Gene: ENSPANG00000014366   Transcript: ENSPANT00000029272
Sequence length 426
Comment pep:known_by_projection chromosome:PapAnu2.0:14:19891266:19932573:1 gene:ENSPANG00000014366 transcript:ENSPANT00000029272 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLSVPVIALGATLGTATSILALCGVTCLCRHMHPKKGLLPRDQDPDPEKAKPSLLGSAQ
QFNVKKSTEPVQPRALLKFPDIYGPRPAVTAPEVINYADYSLRSTEEPTAPASPQPPNDS
RLKRQVTEELFILPQNGVVEDVCVMETWNPEKAASWNQAPKLHYCLDYDRQKAELFVTCL
EAVTSNHDGGCDCYVQGSVANRTGSVEAQTALKKRQLHTTWEEGLVLPLAEEELPTATLT
LTLRTCDRFSRHSVAGELCLGLDGTSVPLGAAQWGELKTSAKEPSAGAGEVLLSISYLPA
ANRLLVVLIKAKNLHSNQSKELLGKDVSVKVTLKHQARKLKKKQTKRAKHKINPVWNEMI
MFELPDDLLQASSVELEVLGQDESGQSCALGHCSLGLHTSGSERSHWEEMLKNPRRQIAM
WHQLHL
Download sequence
Identical sequences A0A096NRJ2
ENSPANP00000015662

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]