SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000015670 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000015670
Domain Number 1 Region: 24-105
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.99e-18
Family Glutathione S-transferase (GST), N-terminal domain 0.0042
Further Details:      
 
Domain Number 2 Region: 202-300
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 5.99e-18
Family Glutathione S-transferase (GST), C-terminal domain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000015670   Gene: ENSPANG00000014645   Transcript: ENSPANT00000006638
Sequence length 358
Comment pep:known_by_projection chromosome:PapAnu2.0:8:70143033:70156600:1 gene:ENSPANG00000014645 transcript:ENSPANT00000006638 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGRQEEQRGSPPLRAEGKADAEVKLILYHWTHSFSSQKVRLVIAEKALKCEEHDVSLPL
SEHNEPWFMRLNSTGEVPVLIHGENIICEATQIIDYLEQTFLDERTPRLMPDKGSMYYPR
VQHYRELLDSLPMDAYTHGCILHPELTVDSMIPAYATTRIRSQIGNTESELKKLAEENPD
LQEAYIAKQKRLKSKLLDHDNVKYLKKILDELEKVLDQVETELQRRNEETPEEGQQPWLC
GESFTLADVSLAVTLHRLKFLGFARRNWGNGKRPNLETYYERVLKRKTFNKVLGHVNNIL
ISAVLPTAFRVAKKRAPKVLGTTLVVGLLAGVGYFAFMLFRKRLGSMILAFRPRPNYF
Download sequence
Identical sequences A0A096NRK0 A0A0D9RM17 A0A2K5L369 A0A2K5WKU9 A0A2K6NV49 F6X699
ENSPANP00000015670 XP_001086782.2.72884 XP_005563621.1.63531 XP_007999107.1.81039 XP_010364309.1.97406 XP_011887317.1.92194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]