SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000015721 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000015721
Domain Number 1 Region: 92-234
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 8.24e-27
Family Glutathione S-transferase (GST), C-terminal domain 0.000042
Further Details:      
 
Domain Number 2 Region: 18-88
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000000335
Family Glutathione S-transferase (GST), N-terminal domain 0.00068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000015721   Gene: ENSPANG00000026265   Transcript: ENSPANT00000028836
Sequence length 236
Comment pep:known_by_projection chromosome:PapAnu2.0:15:1229113:1231039:1 gene:ENSPANG00000026265 transcript:ENSPANT00000028836 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAETKLQLFVKASEDGESVGHCPSCQRLFMVLLLKGVPFTLTTVDTRRSPDVLKDFAPGS
QLPILLYDSDAKTDTLQIEDFLEETLGPPDFPSLAPRYRESNTAGNDVFHKFSAFIKNPV
PAQDEALYQQLLRALARLDSYLRAPLEHELALEPQLRESRRRFLDGDRLTLADCSLLPKL
HIVDTVCAHFRQAPIPAGLRGVRRYLDSALQEKEFKYTCPHSAEILAAYRPAVHPR
Download sequence
Identical sequences A0A096NRQ1 A0A0D9RUC3 A0A2K5P8T1 A0A2K5W3M3
XP_005580421.1.63531 XP_011904215.1.92194 ENSPANP00000015721

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]