SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000015741 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000015741
Domain Number 1 Region: 137-179
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000858
Family EGF-type module 0.0067
Further Details:      
 
Domain Number 2 Region: 107-142
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000636
Family EGF-type module 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000015741   Gene: ENSPANG00000026128   Transcript: ENSPANT00000028690
Sequence length 273
Comment pep:known_by_projection chromosome:PapAnu2.0:15:1577400:1585096:-1 gene:ENSPANG00000026128 transcript:ENSPANT00000028690 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWGSQEMLLVWLLVLAAGGTEHAYRPGRRVCAVGAHGDPVSESFVQRVYQPFLTTCDGHR
ACSTYRTIYRTAYRRSPGLAPARPRYACCPGWKRTSGLPGACGAAICQPPCRNGGSCIQP
GRCRCPAGWQGDTCQSDVDECSAGGAGCPQRCVNTAGSYWCQCWEGHRLSADGTHCVPKG
GPPRVAPNLTGVDSAMKEEVQRLQSRVDLLEEKLQLVLAPLHSLASQALEHGLPDPGSLL
VHSFQQLGRIDSLSEQISFLEEQLGSCSCKKDS
Download sequence
Identical sequences A0A096NRS1 A0A2K6AHF4
XP_011840472.1.47321 ENSPANP00000015741

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]