SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000015742 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000015742
Domain Number 1 Region: 358-489
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000267
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 2 Region: 1089-1231
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000011
Family Growth factor receptor domain 0.0095
Further Details:      
 
Domain Number 3 Region: 207-375
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000753
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 4 Region: 775-906
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000251
Family Growth factor receptor domain 0.0098
Further Details:      
 
Domain Number 5 Region: 548-676
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000282
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 6 Region: 673-714
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000362
Family EGF-type module 0.0049
Further Details:      
 
Domain Number 7 Region: 710-748
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000075
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 8 Region: 522-560
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000292
Family EGF-type module 0.0088
Further Details:      
 
Domain Number 9 Region: 905-1020
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000314
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 10 Region: 60-105
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000356
Family EGF-type module 0.0082
Further Details:      
 
Domain Number 11 Region: 1065-1100
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000219
Family EGF-type module 0.011
Further Details:      
 
Domain Number 12 Region: 176-219
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000347
Family EGF-type module 0.02
Further Details:      
 
Domain Number 13 Region: 96-135
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000911
Family EGF-type module 0.0054
Further Details:      
 
Domain Number 14 Region: 479-526
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000259
Family EGF-type module 0.0075
Further Details:      
 
Domain Number 15 Region: 23-59
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000429
Family EGF-type module 0.026
Further Details:      
 
Domain Number 16 Region: 138-180
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000754
Family EGF-type module 0.0087
Further Details:      
 
Domain Number 17 Region: 1408-1441
Classification Level Classification E-value
Superfamily Notch domain 0.0000000798
Family Notch domain 0.0052
Further Details:      
 
Domain Number 18 Region: 1227-1271
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000111
Family EGF-type module 0.014
Further Details:      
 
Domain Number 19 Region: 1448-1480
Classification Level Classification E-value
Superfamily Notch domain 0.000000129
Family Notch domain 0.0043
Further Details:      
 
Domain Number 20 Region: 1310-1347
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000895
Family EGF-type module 0.02
Further Details:      
 
Domain Number 21 Region: 1033-1065
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000012
Family EGF-type module 0.02
Further Details:      
 
Domain Number 22 Region: 1367-1399
Classification Level Classification E-value
Superfamily Notch domain 0.00000131
Family Notch domain 0.00017
Further Details:      
 
Domain Number 23 Region: 1264-1304
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000489
Family EGF-type module 0.016
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000015742
Domain Number - Region: 751-786
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0205
Family EGF-type module 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000015742   Gene: ENSPANG00000026129   Transcript: ENSPANT00000028691
Sequence length 1831
Comment pep:known_by_projection chromosome:PapAnu2.0:15:1732294:1755430:1 gene:ENSPANG00000026129 transcript:ENSPANT00000028691 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADYACSCPLGFSGPLCLTPLDNACLTNPCRNGGTCDLLTLTEYKCRCPPGWSGKSCQQA
DPCASNPCANGGQCLPFEASYICHCPPSFHGPTCRQDVNECGQNPGLCRHGGTCHNEVGS
YRCVCRATHTGPNCERPYVPCSPSPCQNGGTCRPTGDVTHECACLPGFTGQNCEENIDDC
PGNNCKNGGACVDGVNTYNCRCLPEWTGQYCTEDVDECQLMPNACQNGGTCHNTHGGYNC
VCVNGWTGEDCSENIDDCASAACFHGATCHDRVASFYCECPHGRTGLLCHLNDACISNPC
NEGSNCDTNPVNGKAICTCPSGYTGPACSQDVDECSLGANPCEHAGKCINTLGSFECQCL
QGYTGPRCEIDVNECVSNPCQNDATCLDQIGEFQCICMPGYEGVHCEVNTDECASSPCLH
NGRCLDKINEFQCECPTGFTGHLCQYDVDECASTPCKNGAKCLDGPNTYTCVCTEGYTGM
HCEVDIDECDPDPCHYGSCKDGVATFTCLCRPGYTGHHCETNINECSSQPCRHGGTCQDR
DNAYLCFCLKGTTGPNCEINLDDCASSPCDSGTCLDKIDGYECACEPGYTGSMCNINIDE
CAGNPCHNGGTCQDGINGFTCRCPEGYHDPTCLSEVNECNSNPCVHGACRDSLNGYKCNC
DPGWSGTNCDINNNECESNPCVNGGTCKDMTSGYVCTCREGFSGPNCQTNINECASNPCL
NQGTCIDDVAGYKCNCLLPYTGATCEVVLAPCAPSPCRNGGECRESEDYESFSCVCPTGW
QGQTCEVDINECVVSPCRHGASCQNTHGGYRCHCQAGYSGRNCETDIDDCRPNPCHNGGS
CTDGVNTAFCDCLPGFQGTFCEEDINECASDPCRNGANCTDCVDSYTCTCPAGFSGIHCE
NNTPDCTESSCFNGGTCVDGINSFTCLCPPGFTGSYCQHDVNECDSQPCLHGGTCQDGCG
SYRCTCPQGYTGPNCQNLVHWCDSSPCKNGGKCWQTHTQYRCECPSGWTGLYCDVPSVSC
EVAAQRQGVDVARLCQHGGLCVDAGNTHHCRCQAGYTGSYCEDLVDECSPSPCQNGATCT
DYLGGYSCKCVAGYHGVNCSEEIDECLSHPCQNGGTCLDLPNTYKCSCPRGTQGVHCEIN
VDDCNPPVDPVSRSPKCFNNGTCVDQVGGYSCTCPPGFVGERCEGDVNECLSNPCDARGT
QNCVQRVNDFHCECRAGHTGRRCESVINGCKGKPCKNGGTCAVASNTARGFICKCPAGFE
GATCENDARTCGSLRCLNGGTCISGPRSPTCLCLGPFTGPECQFPASSPCLGGNPCYNQG
TCEPTSESPFYRCLCPAKFNGLLCHILDYSFGGGAGRDIPPPQIEEACELPECQEDAGNK
VCSLQCNNHACGWDGGDCSLNFNDPWKNCTQSLQCWKYFSDGHCDSQCNSAGCLFDGFDC
QRAEGQCNPLYDQYCKDHFSDGHCDQGCNSAECEWDGLDCAEHVPERLAAGTLVVVVLMP
PEQLRNSSFHFLRELSRVLHTNVVFKRDAHGQQMIFPYYGREEELRKHPIKRAAEGWAAP
EALLGQVKASLLPGGGGGGRRRRELDPMDVRGSIVYLEIDNRQCVQASSQCFQSATDVAA
FLGALASLGSLNIPYKIEAVQSETVEPPPPAQLHFMYVAAAAFVLLFFVGCGVLLSRKRR
RQHGQLWFPEGFKVSEASKKKRREPLGEDSVGLKPLKNASDGALMDDNQNEWGDEDLETK
KFRFEEPVVLPDLDDQTDHRQWTQQHLDAADLRMSAMAPTPPQGEVDADCMDVNVRGPGK
GASSQGFPSSVAHLPLSPKPRGWGTVDTLET
Download sequence
Identical sequences ENSPANP00000015742

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]