SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000015752 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000015752
Domain Number 1 Region: 188-386
Classification Level Classification E-value
Superfamily TPR-like 5.6e-31
Family Tetratricopeptide repeat (TPR) 0.0092
Further Details:      
 
Domain Number 2 Region: 26-162
Classification Level Classification E-value
Superfamily TPR-like 1.19e-16
Family Tetratricopeptide repeat (TPR) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000015752   Gene: ENSPANG00000026118   Transcript: ENSPANT00000028629
Sequence length 676
Comment pep:known_by_projection chromosome:PapAnu2.0:15:1898685:1934234:-1 gene:ENSPANG00000026118 transcript:ENSPANT00000028629 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EASAAPPHMDEELPGPAARRLYSRMEASCLELALEGERLCKAGDFKAGVAFFEAAVQVGT
EDLKTLSAIYSQLGNAYFYLKEHGRALEYHKHDLLLARTIGDRMGEAKASGNLGNTLKVL
GRFDEAAVCCQRHLSIAQEQGDKVGEARALYNIGNVYHAKGKQLSWNAANATQDPGHLPP
DVRETLCKASEFYERNLSLVKELGDRAAQGRAYGNLGNTHYLLGNFTEATTFHKERLAIA
KEFGDKAAERRAYSNLGNAHVFLGRFDVAAEYYKKTLQLSRQLRDQAVEAQACYSLGNTY
TLLQDYERAAEYHLRHLLIAQELADRVGEGRACWSLGNAYVSMGRPAQALTFAKKHLQIS
QEIGDRHGELTARMNVAQLQLVLGRLTSPAASEKPDLAGYEAQGARPKRTQRLSTETWDL
LRLPLEREQNGDSHHAGDWRGPSRDSLPIPVRSRKYQEGPDAERRPREGSHSTLDSADVR
VHVPRTSIPRAPSSDEECFFDLLTKFQSSRMDDQRCPLDDGQAGAAEATAAPTLEDRIAQ
PSMTASPQTEEFFDLIASSQSRRLDDQRASVGSLPGLRITHSNAGHLRGHGEPQEPGDDF
FNMLIKYQSSRIDDQRCPPPDVLPRGPTMPDEDFFSLIQRVQAKRMDEQRVDLAGGPEQG
TGGPPEPQQQCQPGSS
Download sequence
Identical sequences ENSPANP00000015752

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]