SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000015760 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000015760
Domain Number 1 Region: 103-193
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.11e-31
Family F-box associated region, FBA 0.0002
Further Details:      
 
Domain Number 2 Region: 18-78
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000000106
Family F-box domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000015760   Gene: ENSPANG00000020848   Transcript: ENSPANT00000017554
Sequence length 193
Comment pep:known_by_projection scaffold:PapAnu2.0:JH681012.1:4812:8072:1 gene:ENSPANG00000020848 transcript:ENSPANT00000017554 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAWASRGRASRVPAPEPEPEPEEALDLSQLPPELLLVVLSHVPPRTLLGRCRQVCRGWR
ALVDGQALWLLILARDHSATGRALLHLARSCQSPARNARPCPLGRFCARRPIGRNLIRNP
CGQEGLRKWMVQHGGDGWVVEENRTTVPGAPSQTCFVTSFSWCRKKQVLDLEEEGLWPEL
LDSGRIEICVSDW
Download sequence
Identical sequences ENSPANP00000015760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]