SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000015783 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000015783
Domain Number 1 Region: 121-158
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000837
Family Cripto EGF-like domain-like 0.0049
Further Details:      
 
Domain Number 2 Region: 87-117
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000678
Family EGF-type module 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000015783   Gene: ENSPANG00000021925   Transcript: ENSPANT00000016686
Sequence length 187
Comment pep:novel chromosome:PapAnu2.0:13:127592252:127598714:1 gene:ENSPANG00000021925 transcript:ENSPANT00000016686 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTWRHHVRFLFTVSLALQIINLGNSYQREKHNGRREEVTKVATQKHQQSPLNWTSSHSGE
VTGSAQGWGPEEPLPYSRAFREGASARPRCCRNGGTCVLGSFCVCPAHFTGRYCEHDQRR
SECGALEHGAWTLRGCHLCRCVFGTLHCLPLQTPGSCDPKDFLASHAPGRGAGGAPHPRS
LVPSVLQ
Download sequence
Identical sequences ENSPANP00000015783

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]