SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000015795 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000015795
Domain Number 1 Region: 496-833
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 5.1e-111
Family PDEase 0.000000315
Further Details:      
 
Domain Number 2 Region: 56-250
Classification Level Classification E-value
Superfamily GAF domain-like 2.43e-32
Family GAF domain 0.00042
Further Details:      
 
Domain Number 3 Region: 237-289,321-458
Classification Level Classification E-value
Superfamily GAF domain-like 5.45e-30
Family GAF domain 0.00079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000015795   Gene: ENSPANG00000019517   Transcript: ENSPANT00000011479
Sequence length 860
Comment pep:known_by_projection chromosome:PapAnu2.0:6:143420755:143502551:-1 gene:ENSPANG00000019517 transcript:ENSPANT00000011479 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGEVTAEEVEKFLDSNIGFAKQYYNLHYRAKVISDLLGAKEAAVDFSNYHSPSSVEESEI
IFDLLRDFQENLQTEKCIFNVLKKLCFLLQADRMSLFMYRTRNGIAELATRLFNVHKDAV
LEDCLVMPDQEIVFPLDMGVVGHVAHSKKIANIPNTEEDEHFCDFVDILTEYKTKNILAS
PIMNGKDVVAIIMAVNKVDGSHFTKRDEEILLKYLNFANLIMKVYHLSYLHNCETRRGQI
LLWSGSKVFEELTDIERQFHKALYTVRAFLNCDRYSVGLLDMTKQKEFFDVWPVLMGEVP
PYSGPRTPDGREINFYKVIDYILHGKEDIKVIPNPPPDHWALVSGLPTYVAQNGLICNIM
NAPAEDFFAFQKEPLDDSGWMIKNVLSMPIVNKKEEIVGVATFYNRKDGKPFDEMDETLM
ESLTQFLGWSVLNPDTYESMNKLENRKDIFQDIVKYHVKCDNEEIQKILKTREVYGKEPW
ECEEEELAEILQAELPDAEKYEINKFHFSDLPLTELELVKCGIQMYYELKVVDKFHIPQE
ALVRFMYSLSKGYRKITYHNWRHGFNVGQTMFSLLVTGKLKRYFTDLEALAMVTAAFCHD
IDHRGTNNLYQMKSQNPLAKLHGSSILERHHLEFGKTLLRDESLNIFQNLNRRQHEHAIH
MMDIAIIATDLALYFKKRTMFQKIVDQSKTYESEQEWTQYMMLEQTRKEIVMAMMMTACD
LSAITKPWEVQSQVALLVAAEFWEQGDLERTVLQQNPIPMMDRNKADELPKLQVGFIDFV
CTFVYKEFSRFHKEITPMLDGITNNRKEWKALADEYDAKMKVQEEEKQKQQSAKPAAAGN
QPGGNPGPGGATTSKSCCIQ
Download sequence
Identical sequences ENSPANP00000015795

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]