SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000015800 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000015800
Domain Number 1 Region: 226-355,610-725,1074-1187
Classification Level Classification E-value
Superfamily TPR-like 1.96e-96
Family Tetratricopeptide repeat (TPR) 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000015800   Gene: ENSPANG00000018410   Transcript: ENSPANT00000019119
Sequence length 1198
Comment pep:known_by_projection chromosome:PapAnu2.0:14:21657549:21798748:-1 gene:ENSPANG00000018410 transcript:ENSPANT00000019119 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVAVGVRGRYELPPCSGPGWLLSLSTLLSVAARGAFATTHWVVTEDGKIQQQVDSPMNL
KHPHDLVILMRQETTVNYLKELEKQLVAQKIHIEENEDRDTGLEQRHNKEDPDCIKAKVP
LGDLDLYDGTYITLESKDISPEDYIDTESPVPPDPQQPDCTKILELPYSIHAFQHLRGVQ
ERVNLSAPLLPKEDPIFTYLSKRLGRSIDDIGHLIHEGLQKNSSSWVLYNMASFYWRIKN
EPYQVVECAMRALHFSSRHNKDIALVNLANVLHRAHFSADAAVVVHAALDDSDFFTSYYT
LGNIYAMLGEYNHSVLCYDHALQAKPGFEQAIKRKHAVLCQQKLEQKLEAQHRSLQRTLN
ELKEYQKQHDHYLRQQEILEKHKLIQEEQILRNIIHETQMAKEAQLGNHQICRLVNQQHS
LHCQWDQPVRYHRGDIFENVDYVQFGEDSSTSSMMSVNFDVQSNQSDINDSVKSSPVAHS
ILWIWGRDSDAYRDKQHILWPKRADCTESYPRVPVGGELPTYFLPPENKGLRIHELSSDD
YSTEEEAQTPDCSITDFRKSHTLSYLVKELEVRMDLKAKMPDDHARKILLSRINNYTVPE
EEIGSFLFHAINKPNAPVWLILNEAGLYWRAVGNSTFAIACLQRALNLAPLQYQDVPLVN
LANLLIHYGLHLDATKLLLQALAINSSEPLTFLSLGNAYLALKNISGALEAFRQALKLTT
KCPECENSLKLIRCMQFYPFLYNITSSVCSGNCHEKTLDNSHDKQKYFDNSQSLDAAEEE
PSERGTEEDPVFSVENSGRDSDALRLESTVVEESNGSDEMENSDETKMSEEILALVDEFQ
QAWPLEGFGGALEMKGRRLDLQGIRVLKKGPQDGVARSSCYGDCRSEDDEATEWITFQVK
RVKKPKGDHKKTPGKKVETSQIENGHRYQANLEITGPKVASPGPQGKKRDYQRLGWPSPD
ECVKLRWVELTAIVSTWLAVSSKNIDITEHIDFATPIQQPAMEPLCNGNLPTSMHTLDHL
HGVSNRASLHYTGESQLTEVLQNLGKDQYPQQSLEQIGTRIAKVLEKNQTSWVLSSMAAL
YWRVKGQGKKAIDCLRQALHYAPHQMKDVPLISLANILHNAKLWNDAVIVATMAVEIAPH
FAVNHFTLGNVYVAMEEFEKALVWYESTLKLQPEFVPAKNRIQTIQCHLMLKKGRRSP
Download sequence
Identical sequences A0A096NRY0
ENSPANP00000015800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]