SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000015805 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000015805
Domain Number 1 Region: 24-141
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.94e-30
Family Spermadhesin, CUB domain 0.0000906
Further Details:      
 
Domain Number 2 Region: 192-304
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.22e-27
Family Spermadhesin, CUB domain 0.0000381
Further Details:      
 
Domain Number 3 Region: 307-372
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000139
Family Complement control module/SCR domain 0.0000117
Further Details:      
 
Domain Number 4 Region: 138-190
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000531
Family EGF-type module 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000015805   Gene: ENSPANG00000014121   Transcript: ENSPANT00000006116
Sequence length 375
Comment pep:novel chromosome:PapAnu2.0:11:7219841:7227643:-1 gene:ENSPANG00000014121 transcript:ENSPANT00000006116 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWLLYLLVPALFCRAGGSIPIPQRLFGEVTSPLFPKPYPNSFETTTVITVPTGYRVKLVF
QHFDLEPSEGCFYDYVKISADKKNLGRFCGQLGSPLGNPPGKKEFMSQGNKMLLTFHTDF
SNEENGTIMFYKGFLAYYQAVDLDECASQSESGEKELQPQCQHLCHNYVGGYFCSCRPGY
ELQKDRHSCQAECSSELYTEASGYISSLEYPRSYPPDLRCNYSIRVERGLTLHLKFLEPF
EIDDHQQVHCPYDQLQIYANGKNIGEFCGKQRPPNLDTSSNAVDLLFFTDESGDSRGWKL
RYTTEIIKCPQPKTLDEFTVIQNLQPQYQFRDYFIATCKLGYQLIEGNQVLHSFTAVCQD
DGTWHRAMPRCKSKS
Download sequence
Identical sequences ENSPANP00000015805

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]