SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000015815 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000015815
Domain Number 1 Region: 371-517
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 4.71e-24
Family Regulator of G-protein signaling, RGS 0.0029
Further Details:      
 
Domain Number 2 Region: 556-674
Classification Level Classification E-value
Superfamily PX domain 6.15e-24
Family PX domain 0.0012
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000015815
Domain Number - Region: 116-210
Classification Level Classification E-value
Superfamily Cytochrome c oxidase subunit E 0.0131
Family Cytochrome c oxidase subunit E 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000015815   Gene: ENSPANG00000004971   Transcript: ENSPANT00000015149
Sequence length 957
Comment pep:known_by_projection chromosome:PapAnu2.0:3:92927208:93079566:1 gene:ENSPANG00000004971 transcript:ENSPANT00000015149 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLTETSLSIWGWGSLGIVLFLITFGPFVIFYLTFYILCFVGGGLVVTLLFGKTNSEKYLE
QCEHSFLPPTSTGVPKCLEEMKREARTIKIDRRLTGANIIDEPLQQVIQFSLRDYVQYWY
YTLSDDESFLLEIRQTLQNALIQFATRSKEIDWQPYFTTRIVDDFGTHLRVFRKAQQKIT
EKDDQVKGTAEDLVDTFFEVEVEMEKEVCRDLVCTSPKDEEGFLRDLCEVLLYLLLPPGD
FQNKIMRYFVREILARGILLPLINQLSDPDYINQYVIWMIRDSNCNYEAFMNIIKLSDNI
GELEAVRDKAAEELQYLRSLDTAGDDINTIKNQINSLLFVKKVCDSRIQRLQSGKEINTV
KLAANFGKLCTVPLDSILVDNVALQFFMDYMQQTGGQAHLFFWMTVEGYRVTAQQQLEVL
LSRQRDGKHQTNQTKGLLRAAAVGIYEQYLSEKASPRVTVDDYLVAKLADTLNHEDPTPE
IFDDIQRKVYELMLRDERFYPSFRQNALYVRMLAELDMLKDPSFRGSDDGDGESFNGSPT
GSINLSLDDLSNVSSDDSVQLHAYISDTGVCNDHGKTYALYAITVHRRNLNSEEMWKTYR
RYSDFHDFHMRITEQFESLSSILKLPGKKTFNNMDRDFLEKRKKDLNAYLQLLLAPEMMK
ASPALAHYVYDFLENKAYSKGKGDFARKMDTFVNPLRNSMRNVSNAVKSLPDSLAEGMTK
MSDNMGKMSERLGQDIKQSFFKVPPLIPKTDSDPEHRRVSAQLDDNVDDNIPLRVMLLLM
DEVFDLKERNQWLRRNIKNLLQQLIRATYGDTINRKIVDHVDWMTSPEQVADSVKRFRDA
FWPNGILAETVPCRDKSIRMRTRVAGKTKLLAIMPDELKHIIGAETTRKGILRVFEMFQH
NQLNRRMVYVFLEGFLETLFPQYKFRELFNKLHSRSKQMQKYKQKLQTTQAPSLQKR
Download sequence
Identical sequences A0A096NRZ5 A0A2K5NML9 A0A2K5X266 A0A2K6DIF2 F6WJA8
ENSPANP00000015815 XP_005550099.1.63531 XP_007980154.1.81039 XP_011729366.1.29376 XP_011923493.1.92194 XP_014989424.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]