SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000015819 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000015819
Domain Number 1 Region: 264-608
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.08e-76
Family p120GAP domain-like 0.0000802
Further Details:      
 
Domain Number 2 Region: 566-708
Classification Level Classification E-value
Superfamily PH domain-like 1.15e-32
Family Pleckstrin-homology domain (PH domain) 0.0045
Further Details:      
 
Domain Number 3 Region: 112-238
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.17e-30
Family Synaptotagmin-like (S variant) 0.0021
Further Details:      
 
Domain Number 4 Region: 7-129
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 6.24e-28
Family PLC-like (P variant) 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000015819   Gene: ENSPANG00000006303   Transcript: ENSPANT00000027434
Sequence length 803
Comment pep:novel chromosome:PapAnu2.0:3:43324119:43358050:-1 gene:ENSPANG00000006303 transcript:ENSPANT00000027434 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKRSSLYIRIVEGKNLPAKDITGSSDPYCIVKVDNEPIIRTATVWKTLCPFWGEEYQVH
LPPTFHTVAFYVMDEDALSRDDVIGKVCLPRDTLASHPKGFSGWTHLTEVDPDEEVQGEI
HLRLEVQPGAQACRLRCSVLEASGSGPKDRNGASDPFVRVRYKGRTQETSIVKKSCYPRW
NETFEFELGEGATEVLCVETWDWDLVSRNDFLGKVVIDIQRLQVAQPEEGWFRLQPDQTK
SRRHDEGNLGSLQLEVRLRDEMVLPSSCYQPLVQLLCHEVKLGMQGPGQLISLIEETTST
ECRQDVATNLLKLFLGQGLAKDFLDLLFQLELSRTSETNTLFRSNSLASKSMEAFLKVAG
MQYLHGVLGPIINKVFEEKKYVELDPSKVEVKDVGCSGLHRPQTEAEVLEQSAQTLRAHL
GALLSALSRSVRACPAVVRATFRQLFRRVRERFPGAQHENVPFIAVTSFLCLRFFSPAIM
SPKLFHLRERHADARTSRTLLLLAKAVQNVGNMDTPASRAKEAWMEPLQPTVRQGVAQLK
DFITKLVDIEEKDELDLQRTLSLQAPPVKEGPLFIHRTKGKGPLMSSSFKKLYFFLTTEA
LSFAKTPSSKKSALIKLANIRAAEKVEEKSFGSSHVMQVIYTDDVGRPQTAYLQCKCVNE
LNQWLSALRKVSINNTGLLGSYHPGVFRGDKWSCCHQKEKTGQGCDKTRSRVTLQEWNDP
LDHDLEAQLIYRHLLGVEAMLWERHRELSRGAEAGTVPASPGEAPKDSLAQLLRVLQDLR
EAHSSSPAGSPPSEPNCLLELQT
Download sequence
Identical sequences ENSPANP00000015819

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]