SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000015904 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000015904
Domain Number 1 Region: 88-211
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 3.13e-33
Family Glutathione S-transferase (GST), C-terminal domain 0.000000592
Further Details:      
 
Domain Number 2 Region: 5-110
Classification Level Classification E-value
Superfamily Thioredoxin-like 9.79e-26
Family Glutathione S-transferase (GST), N-terminal domain 0.000021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000015904   Gene: ENSPANG00000026012   Transcript: ENSPANT00000004982
Sequence length 216
Comment pep:known_by_projection chromosome:PapAnu2.0:7:133392573:133402684:1 gene:ENSPANG00000026012 transcript:ENSPANT00000004982 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQAGKPILYSYFRSSCSWRVRIALALKGIDYETVPINLIKDGGQQFSKDFQALNPMKQVP
ALKIDGITIHQSLAIIEYLEETRPTPRLLPQDPKKRASVRMISDLIAGGIQPLQNLSVLK
QVGEEFQLTWAQNTIISGFNALEQILQSTAGTYCVGDEVTMADLCLVPQVANAERFKVDC
TPYPTISSINKRLLVLEAFQVTHPCRQPDTPTELRA
Download sequence
Identical sequences A0A096NS84
ENSPANP00000015904

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]