SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000015951 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000015951
Domain Number 1 Region: 193-305
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.14e-16
Family Spermadhesin, CUB domain 0.0048
Further Details:      
 
Domain Number 2 Region: 400-438
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000209
Family LDL receptor-like module 0.00081
Further Details:      
 
Domain Number 3 Region: 141-178
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000157
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 4 Region: 37-136
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000798
Family Spermadhesin, CUB domain 0.0047
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000015951
Domain Number - Region: 330-355
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000183
Family LDL receptor-like module 0.003
Further Details:      
 
Domain Number - Region: 358-399
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00131
Family LDL receptor-like module 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000015951   Gene: ENSPANG00000003911   Transcript: ENSPANT00000006713
Sequence length 715
Comment pep:known_by_projection chromosome:PapAnu2.0:7:79509634:79514848:1 gene:ENSPANG00000003911 transcript:ENSPANT00000006713 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLATLLLFLLLLGGALAHPDRIIFPNLACENPPAVLLEVQGTLQRPLVRDSRSSPANCT
WLILGSKEQTVTVRFQKLHLACGSEHLTLRSPLQPPISLCEAPPSPLQLPGGNVTITYSY
AGARAPMGQGFLLSYSQDWLMCLQEEFQCLNHRCVSAVQRCDGIDACGDGSDEAGCSSDP
FPGLTPRPIPSLPCNLTLEDFYGVFSSPGYAHLASVSHPQSCHWLLDPHDGRRLAVRFTA
LDLGFGDAVHVFDGSGPPESSRLLRSLTHFSNGKAVTVETLSGQAVVSYHTVAWSNGRGF
NATYHVRGYCLPWDRPCGLGSGLGAGEGLGERCYSEAQRCDGSWDCADGTDEEDCPGCPP
GHFPCGAAGTSGATACYLPADRCNYQTFCADGADERRCRHCQPGNFRCRDEKCVYETWVC
DGQPDCADGSDEWDCSYVLPRKVITAAVIGSLVCGLLLVIALGCTCKLYAIRTQEYSIFA
PLSRMEAEIVQQQAPPSYGQLIAQGAIPPVEDFPTENPNDNSVLGNLRSLLQILRQDMTP
GGGSGARRRQRGRLMRRLVRRLRRWGLLPRTNTPARASEARSQVTHSAAPLEALDGGTGP
ACEGGAVGGQDGEQAPPLPIKAPLPSASTSPAPTTVPEAPGPLPSLPLEPSLLSGVVQAL
RGRLLPSLGPPGPTRSPAGPHTAVLAPEDEDDVLLVPLAEPGLWVAEAEDEPLLT
Download sequence
Identical sequences A0A096NSD1
ENSPANP00000015951

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]