SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000015957 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000015957
Domain Number 1 Region: 168-282
Classification Level Classification E-value
Superfamily Bromodomain 8.9e-27
Family Bromodomain 0.00056
Further Details:      
 
Domain Number 2 Region: 287-419
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 3.97e-22
Family PWWP domain 0.008
Further Details:      
 
Domain Number 3 Region: 97-152
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000000226
Family PHD domain 0.011
Further Details:      
 
Domain Number 4 Region: 996-1038
Classification Level Classification E-value
Superfamily HIT/MYND zinc finger-like 0.0000000384
Family MYND zinc finger 0.0097
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000015957
Domain Number - Region: 904-993
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.00445
Family Apolipoprotein A-I 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000015957   Gene: ENSPANG00000011740   Transcript: ENSPANT00000028721
Sequence length 1188
Comment pep:known_by_projection chromosome:PapAnu2.0:10:16915681:17060143:1 gene:ENSPANG00000011740 transcript:ENSPANT00000028721 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHPQSLAEEEIKTEQEVVEGMDISTRSKDPGSAERTAQKRKFPSPPHSSNGHSPQDTSTS
PIKKKKKPGLLNSNNKEQSELRHGPFYYMKQPLTTDPVDVVPQDGRNDFYCWVCHREGQV
LCCELCPRVYHAKCLRLTSEPEGDWFCPECEKITVAECIETQSKAMTMLTIEQLSYLLKF
AIQKMKQPGTDAFQKPVPLEQHPDYAEYIFHPMDLCTLEKNAKKKMYGCTEAFLADAKWI
LHNCIIYNGGNHKLTQIAKVVIKICEHEMNEIEVCPECYLAACQKRDNWFCEPCSNPHPL
VWAKLKGFPFWPAKALRDKDGQVDARFFGQHDRAWVPINNCYLMSKEIPFSVKKTKSIFN
SAMQEMEVYVENIRRKFGVFNYSPFRTPYTPNSQYQMLLDPTNPSAGTAKIDKQEKVKLN
FDMTASPKILMSKPVLSGGTGRRISLSDMPRSPMSTNSSVHTGSDVEQDAEKKATSSHFS
ASEESMDFLDKSTASPASTKTGQAGSLSGSPKPFSPQLSTPITTKTDKTSTTGSILNLNL
DRSKAEMDLKELSESVQQQSTPVPLISPKRQIRSRFQLNLDKTIESCKAQLGINEISEDV
YTAVEHSDSEDSEKSDSSDSEYISDDEQKSKNEPEDTEDKEGCRMDKEPSAVKKKPKPTN
PVEIKEELKSTSPASEKTDPGAVKDKASPEPEKDFSEKAKPSPHPTKDKLKGKDETDSPT
VHLGLDSDSESELVIDLGEDHSGREGRKNKKEPKEPSPKQDVVGKAPPSTTAGSQSPPET
PVLTRSSAQTPAAGATATTSTSSTVTVTAPAPAATGSPVKKQRPLLPKETAPAVQRVVWN
SSTVQQKEITQSPSTSTITLVTSTQSSPLVTSSGSTSTLVSSVNADLPIATASADVAADI
AKYTSKMMDAIKGTMTEIYNDLSKNTTGSTIAEIRRLRIEIEKLQWLHQQELSEMKHNLE
LTMAEMRQSLEQERDRLIAEVKKQLELEKQQAVDETKKKQWCANCKKEAIFYCCWNTSYC
DYPCQQAHWPEHMKSCTQSATAPQQEADAEVNTETLNKSSQGSSSSTQSAPSETASASKE
KETSTEKSKDSGSTLDLSGSRETPSSILLGSNQGSVSKRCDKQPAYAPTTTDHQPHPNYP
AQKYHSRSSKSSWSSSDEKRGSTRAEHNSSTSTKSLLPKESRLDTFWD
Download sequence
Identical sequences ENSPANP00000015957

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]