SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000015970 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000015970
Domain Number 1 Region: 187-216,269-509
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.03e-80
Family Eukaryotic proteases 0.00000001
Further Details:      
 
Domain Number 2 Region: 82-145
Classification Level Classification E-value
Superfamily GLA-domain 9.08e-24
Family GLA-domain 0.00014
Further Details:      
 
Domain Number 3 Region: 135-166
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000046
Family EGF-type module 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000015970   Gene: ENSPANG00000000902   Transcript: ENSPANT00000001329
Sequence length 530
Comment pep:known chromosome:PapAnu2.0:17:89835334:89869495:1 gene:ENSPANG00000000902 transcript:ENSPANT00000001329 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSEGVDRPRSTAGRTPSQACEQRRSPPPGRGGKLRCPRCVGQGRGAVSEDWARQAVSVSR
NSRFSVFVTQEEAHGVLHRQRRANSFLEELRPGSLERECKEEQCSFEEAREIFKDLERTN
EFWNKYKDGDQCETSPCQNEGKCRDGLGEYTCTCLEGFEGKNCELFTRKLCSLDNGDCDQ
FCHEEQNSVVCSCARGYTLADNGKACIPTGPYPCGKQTLERRKRSAAQATNSSGEASDSI
IWKPDDAADLDATENPFDLLDFNQTQPERGDNNLIRIVGGRECENGECPWQALLINEENE
GFCGGTILSEFYILTAAHCLYQAKRFKVRVGDRDMEQEEGGEAVHEVEVIIKHNRFTKET
YDFDIAVLRLKSPITFRMNVAPACLPERDWAESTLMTQKTGIVSGFGRTHEKGRQSTRLK
MLEVPYVDRNSCKLSSSFIITQNMFCAGYHAKQEDACQGDSGGPHVTRFKDTYFVTGIVS
WGEGCARKGKYGIYTKVTAFLKWIDRSMKTRGLPKAESRAPEVSTSSPLK
Download sequence
Identical sequences ENSPANP00000015970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]