SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000016006 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000016006
Domain Number 1 Region: 6-180
Classification Level Classification E-value
Superfamily EF-hand 7.32e-28
Family Calmodulin-like 0.0085
Further Details:      
 
Domain Number 2 Region: 185-238
Classification Level Classification E-value
Superfamily EF-hand 0.00000000248
Family Parvalbumin 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000016006   Gene: ENSPANG00000016519   Transcript: ENSPANT00000020256
Sequence length 271
Comment pep:known_by_projection chromosome:PapAnu2.0:20:55134131:55170747:-1 gene:ENSPANG00000016519 transcript:ENSPANT00000020256 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGPQQQPPYLHLAELTASQFLEIWKHFDADGNGYIEGKELENFFQELEKARKGSGMMSK
SDNFGEKMKEFMQKYDKNSDGKIEMAELAQILPTEENFLLCFRQHVGSSAEFMEAWRKYD
TDRSGYIEANELKGFLSDLLKKANRPYDEPKLQEYTQTILRMFDLNGDGKLGLSEMSRLL
PVQENFLLKFQGMKLTSEEFNAIFTFYDKDGSGYIDEHELDALLKDLYEKNKKEMNIQQL
TNYRKSVMSLAEAGKLYRKDLEIVLCSEPPM
Download sequence
Identical sequences A0A096NSI5 A0A0D9QW94 A0A2I2YTV9 A0A2I3S4W2 A0A2K5MZQ1 A0A2K5ZSW4 A0A2K6D5X5 A0A2K6MCB7 A0A2K6RQI5 G7NQP7 G7Q1K6
XP_003829535.1.60992 XP_005592534.1.63531 XP_007991904.1.81039 XP_010352346.1.97406 XP_011755863.1.29376 XP_011832146.1.47321 XP_011896615.1.92194 XP_016785615.1.37143 XP_017724250.1.44346 XP_018868416.1.27298 ENSPANP00000016006

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]