SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000016025 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000016025
Domain Number 1 Region: 9-158
Classification Level Classification E-value
Superfamily PH domain-like 3.47e-49
Family Phosphotyrosine-binding domain (PTB) 0.00048
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000016025
Domain Number - Region: 162-195
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.0105
Family Mitotic arrest deficient-like 1, Mad1 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000016025   Gene: ENSPANG00000013330   Transcript: ENSPANT00000017097
Sequence length 304
Comment pep:known_by_projection chromosome:PapAnu2.0:12:50277507:50506793:1 gene:ENSPANG00000013330 transcript:ENSPANT00000017097 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNRAFSRKKDKTWMHTPEALSKHFIPYNAKFLGSTEVEQPKGTEVVRDAVRKLKFARHIK
KSEGQKIPKVELQISIYGVKILEPKTKEVQHNCQLHRISFCADDKTDKRIFTFICKDSES
NKHLCYVFDSEKCAEEITLTIGQAFDLAYRKFLESGGKDVETRKQIAGLQKRIQDLETEN
MELKNKVQDLENQLRITQVSTSPAGSMTSQSPSTDIFDMIPFSPISHQSSMPTRNGTQPP
PVPSRSTEIKRDLFGAEPFDPFNCGAADFPPDIQSKLDEMQEGFKMGLTLEGTVFCLDPL
DSRC
Download sequence
Identical sequences A0A2I3LG99
ENSPANP00000016025

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]