SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000016027 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000016027
Domain Number 1 Region: 15-140
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 5.17e-28
Family Dual specificity phosphatase-like 0.0000028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000016027   Gene: ENSPANG00000020123   Transcript: ENSPANT00000006919
Sequence length 166
Comment pep:novel chromosome:PapAnu2.0:12:19970469:19970993:1 gene:ENSPANG00000020123 transcript:ENSPANT00000006919 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARMNHPVPVEVTYKNMFLTTHNPTNVTLNKFIEELKKYGVFTIRVCEATYDTALLEKEG
IHVLNWPFDDGAPPSNQIVDNWLSLVKFKFRKEPGCGTAVHCIADLGRAPVLVALALIEG
KMKDEDAVQFIREKQRRAFNSKRSIVLKMWLRFKDSSGHRYNCCSQ
Download sequence
Identical sequences ENSPANP00000016027

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]