SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000016034 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000016034
Domain Number 1 Region: 1130-1395
Classification Level Classification E-value
Superfamily YWTD domain 6.02e-52
Family YWTD domain 0.00000208
Further Details:      
 
Domain Number 2 Region: 400-662
Classification Level Classification E-value
Superfamily YWTD domain 4.84e-47
Family YWTD domain 0.00000537
Further Details:      
 
Domain Number 3 Region: 1750-1995
Classification Level Classification E-value
Superfamily YWTD domain 7.32e-47
Family YWTD domain 0.0000178
Further Details:      
 
Domain Number 4 Region: 1445-1702
Classification Level Classification E-value
Superfamily YWTD domain 3.01e-43
Family YWTD domain 0.0000226
Further Details:      
 
Domain Number 5 Region: 75-331
Classification Level Classification E-value
Superfamily YWTD domain 1.28e-42
Family YWTD domain 0.0000493
Further Details:      
 
Domain Number 6 Region: 2797-3052
Classification Level Classification E-value
Superfamily YWTD domain 1.44e-41
Family YWTD domain 0.0000202
Further Details:      
 
Domain Number 7 Region: 2059-2326
Classification Level Classification E-value
Superfamily YWTD domain 3.66e-32
Family YWTD domain 0.00011
Further Details:      
 
Domain Number 8 Region: 2709-2789,3045-3106
Classification Level Classification E-value
Superfamily Growth factor receptor domain 7.53e-24
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 9 Region: 4-63,340-387
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000188
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 10 Region: 747-792
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000101
Family LDL receptor-like module 0.00069
Further Details:      
 
Domain Number 11 Region: 3413-3449
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000123
Family LDL receptor-like module 0.00095
Further Details:      
 
Domain Number 12 Region: 790-830
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000157
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 13 Region: 3539-3579
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000183
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 14 Region: 712-751
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000034
Family LDL receptor-like module 0.00057
Further Details:      
 
Domain Number 15 Region: 3334-3369
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000432
Family LDL receptor-like module 0.00084
Further Details:      
 
Domain Number 16 Region: 3374-3411
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000445
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 17 Region: 3455-3500
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000471
Family LDL receptor-like module 0.00089
Further Details:      
 
Domain Number 18 Region: 3252-3292
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000537
Family LDL receptor-like module 0.00094
Further Details:      
 
Domain Number 19 Region: 3134-3174
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000602
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 20 Region: 835-873
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000615
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 21 Region: 2542-2577
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000641
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 22 Region: 2672-2713
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000072
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 23 Region: 1092-1123,1400-1439,1696-1745
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000091
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 24 Region: 875-913
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000131
Family LDL receptor-like module 0.00026
Further Details:      
 
Domain Number 25 Region: 922-958
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000183
Family LDL receptor-like module 0.00057
Further Details:      
 
Domain Number 26 Region: 2462-2498
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000196
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 27 Region: 2415-2456
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000275
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 28 Region: 2584-2620
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000038
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 29 Region: 3291-3331
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000406
Family LDL receptor-like module 0.0009
Further Details:      
 
Domain Number 30 Region: 3097-3132
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000471
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 31 Region: 3217-3253
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000707
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 32 Region: 3176-3213
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000119
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 33 Region: 2501-2538
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000131
Family LDL receptor-like module 0.00083
Further Details:      
 
Domain Number 34 Region: 1044-1089
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000439
Family EGF-type module 0.014
Further Details:      
 
Domain Number 35 Region: 2380-2417
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000157
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 36 Region: 2621-2661
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000017
Family LDL receptor-like module 0.00087
Further Details:      
 
Domain Number 37 Region: 1004-1040
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000524
Family LDL receptor-like module 0.0025
Further Details:      
 
Domain Number 38 Region: 968-1001
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000772
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 39 Region: 2014-2063
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000116
Family EGF-type module 0.0085
Further Details:      
 
Domain Number 40 Region: 3582-3663
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000596
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 41 Region: 668-704
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000067
Family EGF-type module 0.02
Further Details:      
 
Domain Number 42 Region: 3501-3533
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000694
Family LDL receptor-like module 0.003
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000016034
Domain Number - Region: 2334-2395
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0529
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000016034   Gene: ENSPANG00000007101   Transcript: ENSPANT00000014466
Sequence length 3680
Comment pep:known_by_projection chromosome:PapAnu2.0:12:2635888:3550829:-1 gene:ENSPANG00000007101 transcript:ENSPANT00000014466 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVGNSTRCYCENGFEIKEDGRSCKDQDECAVYGTCSQTCRNTHGSYACSCVEGYLMQSDN
RSCKAKIEPTDRPPILLITNFETIEIFYLNGSKMATLSSVNGNEIHALDFIYNEDMICWI
ESRESSNQLKCIQITKAGGLTDEWTINILQSFHNVQQMAIDWLTRNLYFVDHVSDRIFVC
NYNGSVCITLIDLELHNPKAIAVDPIAGKLFFTDYGNVAKVERCDMDGMNRTRIIDSKTE
QPAALALDLVNKLVYWVDLYLDYVGVVDYQGKNRHAIIQGRQVRHLYGITVFEDYLYATN
SDNYNIIRINRFNGTDIHSLIKMENARGIRIYQKRTQPTVRSHACEVDPYGMPGGCSHIC
LLSSSYKTRTCRCRTGFNLGSDGRSCKRPKNELFLFYGKGRPGIVRGMDLNTKIADEYMI
PIENLVNPRALDFHAETNYIYFADTTSFLIGRQKIDGTERETILKDDLDNVEGIAVDWIG
NNLYWTNDGHRKTINVARLEKASQSRKTLLEGEMSHPRGIVVDPINGWMYWTDWEEDEID
DSVGRIEKAWMDGFNRQIFVTSKMLWPNGLTLDFHTNTLYWCDAYYDHIEKVFLNGTHRK
IVYSGRELNHPFGLSHHGNYVFWTDYMNGSIFQLDLITSEVTLLRHERPPLFGLQIYDPR
KQQGDNMCRVNNGGCSTLCLAIPGGRVCACADNQLLDENGTTCTFNPGEALPRICKAGEF
RCKNRHCIQARWKCDGDDDCLDGSDEDSVNCFNHSCPDDQFKCQNNRCIPKRWLCDGAND
CGSNEDESNQTCAARTCQVDQFSCGNGRCIPRAWLCDREDDCGDQTDEMTSCEFPTCEPL
TQFVCKSGRCISSKWHCDSDDDCGDGSDEVGCVHSCFDNQFRCSSGRCIPGHWACDGDND
CGDFSDEAQINCTKEEIHSPAGCNGNEFQCHPDGNCIPDLWRCDGEKDCEDGSDEKGCNG
TIRLCDHKTKFSCWSTGRCINKAWVCDGDIDCEDQSDEDDCDSFLCGPPKYPCANDTSVC
LQPEKLCNGKKDCPDGSDEGDLCDECSLNNGGCSNHCSVVPGRGIVCSCPEGLQLNKDNK
TCEIVDYCSNHLKCSQVCEQHKHTVKCSCYEGWKLDVDGESCTSVDPFEAFIIFSIRHEI
RRIDLHKRDYSLLVPGLRNTIALDFHFNQSLLYWTDVVEDRIYRGKLSESGGVSAIEVVV
EHGLATPEGLTVDWIAGNIYWIDSNLDQIEVAKLDGSLRTTLIAGAMEHPRAIALDPRYG
ILFWTDWDANFPRIESASMSGAARKTIYKDMKTGAWPNGLTVDHFEKRIVWTDARSDAIY
SALYDGTNMIEIIRGHEYLSHPFAVSLYGSEVYWTDWRTNTLSKANKWTGQNVSVIQKTS
AQPFDLQIYHPSRQPHAPNPCAANDGKGPCSHMCLINHNRSAACACPHLMKLSSDKKTCY
EMKKFLLYARRSEIRGVDIDNPYFNFITAFTVPDIDDVTVIDFDASEERLYWTDIKTQTI
KRAFINGTGLETVISRDIQSIRGLAVDWVSRNLYWISSEYDETQINVARLDGSLKTSIIH
GIDKPQCLAAHPVRGKLYWTDGNTINMANMDGSNSKILFQNQKEPVGLSIDYVENKLYWI
SSGNGTINRCNLDGGNLEVIESMKEELTKATALTIMDKKLWWADQNLAQLGTCSKRDGRN
PTILRNKTSGVVHMKVYDKEAQQGSNSCQLNNGGCSQLCLPTSETTRTCMCTVGYYLQKN
RMSCQGIESFLMYSVHEGIRGIPLEPSDKMDALMPISGTSFAVGIDFHAENDTIYWTDMG
FNKISRAKRDQTWKEDIITNGLGRVEGIAIDWIAGNIYWTDHGFNLIEVARLNGSFRYVI
ISQGLDQPRSIAVHPEKGLLFWTEWGQMPCIGKARLDGSEKVVLVSMGIAWPNGISIDYE
ENKLYWCDARTDKIERIDLEAGGHREVVLSGSNVDMFSVAVFGAYIYWSDRAHANGSVRR
GHKNDATETITMRTGLGVNLKEVKIFNRVREKGTNVCARDNGGCKQLCLYRGNSQRTCAC
AHGYLAEDGVTCLRHEGYLLYSGRTILKSIHLSDETNLNSPIRPYENPHYFKNVIALAFD
YNQRRKGTNRIFYSDAHFGNIQLIKDNWEDRQVIVENVGSVEGLAYHRAWDTLYWTSSTT
SSITRHTVDQTRPGAFDREAVITMSEDDHPHVLALDECQNLMFWTNWNEQHPSIMRSTLT
GKNAQVVVSTDILTPNGLTIDYRAEKLYFSDGSLGKIERCEYDGSQRHVIVKSGPGTFLS
LAVYDNYIFWSDWGRRAILRSNKYTGGDTKILRSDIPHQPMGIIAVANDTNSCELSPCAL
LNGGCHDLCLLTPNGRVNCSCRGDRILLEDNRCVTKNSSCNIYSEFECGNGECIDYQLTC
DGIPHCKDKSDEKLLYCENRSCRRGFKPCYNRRCIPHGKLCDGENDCGDNSDELDCKVQN
KHKCEENYFSCPSGRCILTTWICDGQQDCEDGLDEFHCDSSCSWNQFACSAQKCISKHWI
CDGEDDCGDGLDESDSICGAATCAADMFSCQGSHACVPRHWLCDGERDCPNGSDELSTAG
CAPNNTCDENAFMCHNKVCIPKQFVCDHDDDCGDGSDESPQCGYRQCGTEEFSCADGRCL
LNTQWQCDGDFDCPDHSDEAPLNPKCKSAEQSCNSSFFMCKNGRCIPSGGLCNNKDDCGD
GSDERNCHINECLSKKVSGCSQDCQDLPISYKCKCWPGFQLKDDGKTCVDIDECSSGFPC
SQQCINTYGTYKCLCTDGYEIQPDNPNGCKSLSDEEPFLILADHHEIRKISTDGSNYTLL
KQGLNNVIAIDFDYREEFIYWIDSSRPNGSRINRMCLNGSDIKVVHNTAVPNALAVDWIG
KNLYWSDTEKRIIEVSKLNGLYPTILVSKRLKFPRDLSLDPRAGYLYWIDCCEYPHIGRV
GMDGTNQSVVIETKISRPMALTIDYVNHRLYWADENHIEFSNMDGSHRHKVPNQDIPGVI
ALTLFEDYIYWTDGKTKSLSRAHKTSGADRLSLINSWHAITDIQVYHSYRQPDVSKHLCM
INNGGCSHLCLLAPGKTHTCACPTNFYLAADNRTCLSNCTASQFRCKTDKCIPFWWKCDT
VDDCGDGSDEPDDCPEFKCQPGRFQCGTGLCALPAFICDGENDCGDNSDELNCDTHVCLS
GQFKCTKNQKCIPVNLRCNGQDDCGDEEDERDCPENSCSPDYFQCKTTKHCISKLWVCDE
DPDCADASDEANCDKKTCGPHEFQCKNNNCIPDHWRCDSQNDCSDNSDEENCKPQTCTLK
DFLCANGDCVSSRFWCDGDFDCADGSDERNCEISCSKDQFQCSNGQCIPAKWKCDGHEDC
KYGEDEKSCEPASPTCSSSEYICASGGCISASLKCNGEYDCADGSDEMDCVTECKEDQFR
CKNKARCIPIRWLCDGIHDCVDGSDEENCDRGGNICRADEFLCNNSLCKLHSWVCDGEDD
CGDNSDEAPDMCVKFLCPSTRPHRCRNNRICLQSEQMCNGIDDCGDNSDEDHCSGKLTYK
ARPCKKDEFACSNKKCIPMDLQCDRLDDCGDGSDEQGCRIAPTEYTCEDNVNPCGDDAYC
NQIKTSVFCQCKPGFQRNMKNRQCEDLNECLVFGTCSHQCINVEGSYKCVCDQNFQERNN
TCIAKGKIITTITNTITILL
Download sequence
Identical sequences ENSPANP00000016034

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]