SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000016039 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000016039
Domain Number 1 Region: 80-123
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000548
Family Pleckstrin-homology domain (PH domain) 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000016039   Gene: ENSPANG00000009645   Transcript: ENSPANT00000013089
Sequence length 138
Comment pep:novel chromosome:PapAnu2.0:12:5477281:5560633:1 gene:ENSPANG00000009645 transcript:ENSPANT00000013089 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQKSTNSDTSLETLNSTRQGTGAVQMRIKNANSHHDRLSQSKSMILTDVGKVTEPISRHR
RNHSQHILKDVIPPLEQLMVEKEGYLQKAKIADGGKKLRKNWSTSWIVLSSRKIEFYKES
KQQALSNMSFCLKCSGGT
Download sequence
Identical sequences A0A096NSL8 A0A1D5RIZ0 A0A2K5J785 A0A2K5MLM2 A0A2K5UGT6 A0A2K5ZUQ0 A0A2K6BXD3
ENSPANP00000016039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]