SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000016040 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000016040
Domain Number 1 Region: 121-314
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.14e-59
Family BCR-homology GTPase activation domain (BH-domain) 0.0000409
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000016040
Domain Number - Region: 1-44
Classification Level Classification E-value
Superfamily PH domain-like 0.00523
Family Pleckstrin-homology domain (PH domain) 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000016040   Gene: ENSPANG00000009773   Transcript: ENSPANT00000013093
Sequence length 319
Comment pep:known_by_projection chromosome:PapAnu2.0:12:5757659:6075352:1 gene:ENSPANG00000009773 transcript:ENSPANT00000013093 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FQITTVSGNEFLLQSDIDFIILDWFHAIKNAIDRLPKDSSCPSRNLELFKIQRSSSTELL
SHYDSDIKEQKPEHRKSLMFRLHHSASDTSDKNRVKSRLKKFITRRPSLKTLQEKGLIKD
QIFGSHLHKVCERENSTVPWFVKQCIEAVEKRGLDVDGIYRVSGNLATIQKLRFIVNQEE
KLNLDDSQWEDIHVVTGALKMFFRELPEPLFPYSFFERFVEAIKKQDNNTRIEAVKCLVQ
KLPPPNRDTMKVLFGHLTKIVAKASKNLMSTQSLGIVFGPTLLRAENETGNMAIHMVYQN
QIAELMLSEYSKIFSSEED
Download sequence
Identical sequences ENSPANP00000016040

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]