SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000016110 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000016110
Domain Number 1 Region: 43-135
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.69e-32
Family Ubiquitin-related 0.00000485
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000016110   Gene: ENSPANG00000020191   Transcript: ENSPANT00000028939
Sequence length 135
Comment pep:novel chromosome:PapAnu2.0:16:66553148:66570367:-1 gene:ENSPANG00000020191 transcript:ENSPANT00000028939 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PSPSSTAAASFFCRSWCCLCARLVRTWYLFCEAAAEETPALAMADEKPKEGVKTENNDHI
NLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEM
EDEDTIDVFQQQTGG
Download sequence
Identical sequences ENSPANP00000016110

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]