SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000016137 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPANP00000016137
Domain Number - Region: 130-273
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0638
Family BAR domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000016137   Gene: ENSPANG00000020137   Transcript: ENSPANT00000022397
Sequence length 697
Comment pep:novel chromosome:PapAnu2.0:7:25534:31636:1 gene:ENSPANG00000020137 transcript:ENSPANT00000022397 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
STDLFHMKRSLRYFEEESKDLVGHLQHSLQHRGELQWALSAVTATQKKVDRVSPTTRPVP
WEPGFADGGVSLRVPSAGWSGLPRRQHGLVSLLLCVVVRGSLGLSNFPLPICTPNPSQFS
SHSQAVTEWQLEQSIQEKARLKASLTQLKESLKQVQLERDEYAQHIKERVWWQQRMRKMS
QEVCTLKKQKKDDMRRVENLERSLSKLNNQMAEPLSPEPPAVPPEEELQHLRKELERVSA
ELQAHVENHQHVSLLNQAQKEKLREQEETLQQLPEPQSSVEELNNENKSAVQLEQQVEEL
QEKLGEVKETVELKSQEAQSLQQQPDHYLGHLQQSVAIYQQQQPTSEKEALHRQLLQQTQ
LMNQLQQQEAWGKAVAEMARQKKHLEAARQQNQQLQDQLSLTALPGEGTGDHSEEEERAP
GEEEEGPRPMPSVPEDLESWEAMVPFFKSAGASAQEEQAWLSEQVKEQRVCCQRMAHPVA
SAQKEPEAAVPAPGAGGESVSRETPWTLQEVMEKLLQSGRMDHLEEKADLREQVEKQYWR
ERCHQPQRLSPVLPQSQGLVPKMRQWEEDIIRLAQGREEMKVACATSLVKLLALQEMLLR
LDYNKGHHKFLATAQNPVEPGPGAPAPQQLGAADKHGDLCEMSLTDSEEPAQAEATEGSP
QDNHSAQPVQEHQEHPGLGSNRSVPFFCWAWLQRRRR
Download sequence
Identical sequences ENSPANP00000016137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]