SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000016153 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000016153
Domain Number 1 Region: 128-368
Classification Level Classification E-value
Superfamily vWA-like 3.84e-72
Family Integrin A (or I) domain 0.00000203
Further Details:      
 
Domain Number 2 Region: 1069-1253
Classification Level Classification E-value
Superfamily Fibronectin type III 5.06e-36
Family Fibronectin type III 0.00000288
Further Details:      
 
Domain Number 3 Region: 1452-1652
Classification Level Classification E-value
Superfamily Fibronectin type III 6.42e-34
Family Fibronectin type III 0.001
Further Details:      
 
Domain Number 4 Region: 931-1049
Classification Level Classification E-value
Superfamily CalX-like 1.83e-20
Family CalX-beta domain 0.00076
Further Details:      
 
Domain Number 5 Region: 580-664
Classification Level Classification E-value
Superfamily Integrin beta tail domain 4.05e-18
Family Integrin beta tail domain 0.0028
Further Details:      
 
Domain Number 6 Region: 27-78
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000324
Family Plexin repeat 0.0018
Further Details:      
 
Domain Number 7 Region: 493-531
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000262
Family Integrin beta EGF-like domains 0.019
Further Details:      
 
Domain Number 8 Region: 535-572
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000391
Family Integrin beta EGF-like domains 0.0091
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000016153
Domain Number - Region: 463-494
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00809
Family Integrin beta EGF-like domains 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000016153   Gene: ENSPANG00000020115   Transcript: ENSPANT00000022702
Sequence length 1747
Comment pep:known_by_projection chromosome:PapAnu2.0:16:67106117:67142315:1 gene:ENSPANG00000020115 transcript:ENSPANT00000022702 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGPRPSPWARLLLAALISVSLSGTLANRCKKAPVKSCTECVRVDKDCAYCTDEMFRDRR
CNTQAELLAAGCQRESIVVMESSFQITEETQIDTTLRRSQMSPQGLRVRLRPGEERHFEL
EVFEPRESPVDLYILMDFSNSMSDDLDNLKKMGQNLAQVLSQLTSDYTIGFGKFVDKVSV
PQTDMRPEKLKEPWPNSDPPFSFKNVISLTEDVDEFRNKLQGERISGNLDAPEGGFDAIL
QTAVCTRDIGWRPDSTHLLVFSTESAFHYEADGANVLAGIMNRNDERCHLDATGTYTQYR
TQDYPSVPTLVRLLAKHNIIPIFAVTNYSYSYYEKLHTYFPVSSLGVLQEDSSNIVELLE
EAFNRIRSNLDIRALDSPRGFRTEVTSKMFPKMKTGSFQIQRGEVGIYQVQLRAIEHVDG
TXRCNFNGDFMCGQCVCSEGWSGQTCNCSTGSLSDIQPCLREGEDKPCSGRGECQCGHCV
CYGEGRYEGQFCEYDNFQCPRTSGFLCNDRGRCSMGQCVCEPGWTGPSCDCPLSNATCID
SNGGICNGRGHCECGRCHCHQQSLYTDTICEINYSAIHPGLCEDLRSCVQCQAWGTGEKK
GRTCEECNFKVKMVDELKRAEEVVVRCSFRDEDDDCTYSYTMEGDGAPGPNSTVLVHKKK
DCPPSSFWWLVLRLLQAQPLPASALCLAQRSSLCCGHSMACLALLPCCNRGHMVGFKEDH
YMLRENLMASDHLDTPMLRSGNLKGRDVVRWKVTNNVQRPGFATHAASINPTELVPYGLS
LRLARLCTENLLKPDTRECAQLRQEVEENLNEVYRQISGGQKLQQTKFRQQPNAGKKQDH
TIVDTVLMAPRSAKPALLSLVLPVPGLRPLPGSPGCLLDTLFQTPRPTSPFSGRIFRFAP
VLFPEGSAWREPSGLMDSGLGWAGLQESRRDVVSFEQPEYSVSRGDQVARIPVIRRVLDG
GKSQVSYRTQDGTAQGNRDYIPVEGELLFQPGEAWKELQVKLLELQEVDSLLRGRQIRRF
HVQLSNPKFGAHLGQPHSTTIIIRDPDELDRSLTRQMVSSQPPPHGDLGAPQNPNAKAAG
SRKIHFNWLPPSGKPMGYRVKYWIQGDSESEAHLLDSKVPSVELTNLYPYCDYEMKVCAY
GAQGEGPYSSLVSCRTHQEVPSEPGRLAFNVVSSTVTQLSWAEPAETNGEITAYEVCYGL
VNDDNRPIGPMKKVLVDNPKNRMLLIENLRESQPYRYTVKARNGAGWGPEREAIINLATQ
PKRPMSIPIIPDIPIVDAQSGEDYDSFLMYSDDVLRSPSGSQRPSVSDDTEHLVNGRMDF
AFPGSANSLHRMTTTGAAAYGTHLSPHVPHRGLSTSSTLTRDYHSLTRSEHSHSTTLPRD
YSTLTSVSSHALGLPPIWEHGRSRLPLSWALGSRSRAQMKGFPPSRGPRDSIILAGRPAA
PSWGPDSRLTAGVPDTPTRLVFSALGPTSLRVSWQPRCERPLQGYSVEYQLLNGGELHRL
NIPNPAQTSVVVEDLLPNHSYVFRVRAQSQEGWGREREGVITIESQVHPQSPLCPLPGSA
FTLSTPSAPGPLVFTALSPDSLQLSWERPRRPNGDIVGYLVTCEMAQGGGPATTFRVDGD
SPESRLTVPGLSENVPYKFKVQARTTEGFGPEREGIITIESQDGGPFPQLGSHAGLFQHP
LQSEYSSITTTHTSATEPFLVDGLTLGAQHLEAGGSLTRHVTQEFVSRTLTTSGTLSTQV
DQQFFQT
Download sequence
Identical sequences ENSPANP00000016153

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]