SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000016168 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000016168
Domain Number 1 Region: 13-336,452-498
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.25e-62
Family FAD-linked reductases, N-terminal domain 0.0053
Further Details:      
 
Domain Number 2 Region: 316-439
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 2.62e-30
Family L-aminoacid/polyamine oxidase 0.00067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000016168   Gene: ENSPANG00000020082   Transcript: ENSPANT00000016371
Sequence length 526
Comment pep:known_by_projection chromosome:PapAnu2.0:9:124863775:124877004:1 gene:ENSPANG00000020082 transcript:ENSPANT00000016371 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEATGSVGKAPGGPRVLVVGGGIAGLGAAQRLCGHSAFPHLRVLEATARAGGRIRSERSF
GGVVEVGAHWIHGPSQGNPVFQLAAEYGLLGEKELSEENQLVETGGHVGLPSVSYASSGA
RVSLQLVAEMATLFYGLIDQTREFLHAAETPVPSVGEYLKKEIGQHVTSWTEDEETRRLK
LAVLNSFFNLECCVSGTHSMDLVALAPFGEYTVLPGLDCTFSKGYQGLTNCMMASLPEDT
VVFEKPVKTIHWNGSFQEAAFPGETFPVSVECEDGDQFPVHHVIVTVPLGFLKEHLDTFF
DPPLPAEKAEAIRKIGFGTNNKIFLEFEEPFWEPDCQLIQLVWDDTSPLEDAAPALQDAW
FRKLIGFVVLPAFASVHVLCGFIAGLESEFMETLSDEEVLLCLTQVLRRMTGNPQLPAPK
SVLRSRWHSAPYTRGSYSYVAVGSTGGDLDLLAQPLPADGAGAQLQILFAGEATHRTFYS
TTHGALLSGWREADRLLSLWAPQAQVTQGLLSPIPTTTRGPALWVP
Download sequence
Identical sequences A0A096NSZ7
ENSPANP00000016168

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]