SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000016171 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000016171
Domain Number 1 Region: 3934-4305
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 5.32e-102
Family Regulator of chromosome condensation RCC1 0.0012
Further Details:      
 
Domain Number 2 Region: 4444-4773
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 3.27e-88
Family Hect, E3 ligase catalytic domain 0.0000354
Further Details:      
 
Domain Number 3 Region: 401-756
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 4.19e-87
Family Regulator of chromosome condensation RCC1 0.0078
Further Details:      
 
Domain Number 4 Region: 2945-3236
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 4.36e-61
Family Regulator of chromosome condensation RCC1 0.0016
Further Details:      
 
Domain Number 5 Region: 2725-2894
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.68e-30
Family APC10-like 0.0064
Further Details:      
 
Domain Number 6 Region: 2533-2610
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 2.86e-29
Family CPH domain 0.00066
Further Details:      
 
Domain Number 7 Region: 3187-3310
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 1.15e-28
Family Regulator of chromosome condensation RCC1 0.046
Further Details:      
 
Domain Number 8 Region: 1841-1907
Classification Level Classification E-value
Superfamily Mib/herc2 domain-like 2.62e-21
Family Mib/herc2 domain 0.00013
Further Details:      
 
Domain Number 9 Region: 1184-1268
Classification Level Classification E-value
Superfamily Cytochrome b5-like heme/steroid binding domain 0.0000000000000432
Family Cytochrome b5 0.0087
Further Details:      
 
Domain Number 10 Region: 2661-2713
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000695
Family ZZ domain 0.006
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000016171
Domain Number - Region: 2433-2485
Classification Level Classification E-value
Superfamily UBA-like 0.00051
Family UBA domain 0.008
Further Details:      
 
Domain Number - Region: 3602-3692
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0256
Family Spermadhesin, CUB domain 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000016171   Gene: ENSPANG00000020118   Transcript: ENSPANT00000028890
Sequence length 4819
Comment pep:known_by_projection chromosome:PapAnu2.0:7:3896887:4409759:-1 gene:ENSPANG00000020118 transcript:ENSPANT00000028890 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QLAFTRDGLCGLWNEMVKDGEIVYTGTESTQNGDLPPRKDDSVEPSGTKKEDMNDKEKKD
EEETPAPVYRAKSILESWVWGKQPAVENLLKCSSVLVKRQCAMVAQSGLCHVLHLQLKSH
YYILGRSFCNIPNTVILELLSGLVSHVGFILPPFERRLISRPAGKGVEGLARVGSRAALS
FAFAFLRRAWRSGEDADLCSELLQESLDALRALPEASLFDESTVSSVWLEVVERATRFLR
SVVTGDVHGTPGTKGPGSIPLQDQHLALAILLELAVQRGTLSQMLSAILLLLQLWDSGAQ
ETDNERSAQGTSAPLLPLLQRFQSIICSKDTPHSEGDMHIIWQPLKWHSPRDLPFIHSPR
PSHLLQGVPQPSLYSQCRLSYAAGPALEHVCSMCAHKGSLQEVIGWGLIGWKYYANVIGP
IQCEGLANLGVTQIACAEKRFLILSRNGRVYTQAYNSDTLAPQLVQGLASRNIVKIAAHS
DGHHYLALAATGEVYSWGCGDGGRLGHGDTVPLEEPKVISAFSGKQAGKHVVHIACGSTY
SAAITAEGELYTWGRGNYGRLGHGSSEDEAIPMLVAGLKGLKVIDVACGSGDAQTLAVTE
NGQVWSWGDGDYGKLGRGGSDGCKTPKLIEKLQDLDVVKVRCGSQFSIALTKDGQVYSWG
KGDNQRLGHGTEEHVRYPKLLEGLQGKKVIDVAAGSTHCLALTEDSEVHSWGSNDQCQHF
DTLRVTKPEPAALPGLDTKHIVGIACGPAQSFAWSSCSEWSIGLRVPFVVDICSMTFEQL
DLLLRQVSEGMDGSADWPPPQEKECVAVATLNLLRLQLHAAISHQVDPEFLGLGLGSVLL
NSLKQTVVTLASSAGVLSTVQSAAQSVLQSGWSVLLPTAEERARALSALLPCAVSGNDVN
ISPGRRFMIDLLVGSLMADGGLESALHAAITAEIQDIEANKEAQKEKEIDEQEANASTFH
RSRTPLDKDLINTGICESSGKQCLPLVQLMQQLLRNIASQTVARLKDVARRISSCLDFEQ
HSRERSASLDLLLRFQRLLISKLYPGESLGQTSDISSPELMGVGSLLKKYTALLCTHIGD
ILPVAASVASTSWRHFAEVACIVEGDFTGVLLPELVVSIVLLLSKNAGLMQEAGAVPLLG
GLLEHLDRFNHLAPGKERDDHEELAWPGIMESFFTGQNCRNNEEVTLIRKADLENHNKDG
GFWTVIDGKVYDIKDFQTQSLTGNSILAQFAGEDPVVALEAALQFEDTRESMHAFCVGQY
LEPDQEVVTIPDLGSLSSPLIDTERNLGLLLGLHASYLAMSTPLSPVEIECAKWLQSSIF
SGGLQTSQIHYSYNEEKDEDHCSSPGGTPASKSRLCSHRRALGDHSQAFLQAIADNNIQD
HNVKDFLCQIERYCRQCHLTTPITFPPEHPVEEVGRLLLCCLLKHEDLGHVALSLVHAGA
LGIEQVKHRALPKSVVDVCRVVYQAKCSLIKTHQEQGRSYKEVCAPVIERLRFLFNELRP
AVCNDLSIMSKFKLLSSLPRWRRIAQKIIRERRKKRVPKKPESTDDEEKIGNEESDLEEA
CILPHSPINVDKRPIAIKSPKDKWQPLLSTVTGVHKYKWLKQNVQGLYPQSPLLSTIAEF
ALKEEPVDVEKMRKCLLKQLERAEVRLEGIDTILKLASKNFLLPSVQYAMFCGWQRLIPE
GIDIGEPLTDCLKDVDLIPPFNRMLLEVTFGKLYAWAVQNIRNVLMDANAKFKELGIQPV
PLQTITNENPSGPSLGTIPQARFLLVMLSMLTLQHGANNLDLLLNSGTLALTQTALRLIG
PSCDNVEEDMNASAQGASATVLEETRKETAPVQLPVSGPELAAMMKIGTRVMRGVDWKWG
DQDGPPPGLGRVIGELGEDGWIRVQWDTGSTNSYRMGKEGKYDLKLAELPAAAQPSAEDS
DTEDDSVEAEQTERNIHPTAMMFTSTINLLQTLCLSAGVHAEIMQSEATKTLCGLLRMLV
ESGTTDKTSSPNRLVCREQHRSWCTLGFVRSIALTPQVCGALSSPQWITLLMKVVEGHAP
FTAASLQRQILAVHLLQAVLPSWDKTERARDMKCLVEKLFGFLGSLLTTCSSDVPLLRES
TPRRRRARPQASLTATHSSTLAEEVVALLRTLHSLTQWNGLINKYINSQLRCVTHSFAGR
PSEGAQLEDYFPDSENPEVGGLMAVLAVIGGIDGRLRLGGQVVHDEFGEGTVTRITPKGR
ITVQFSDMRTCRVCPLSQLKPLPAVAFNVNNLPFTEPMLSVWAQLVNLAGSKLEKHKIKK
STKQAFTGQVDLDLLRCQQLKLYILKAGRALLSHQDKLRQILSQPAVQETGTVHADDGAV
ASPDLGDMSPEGPQPPMILLQQLLASATQPSPVKAIFDKQELEAAALAVCQCLAVESTHP
SSPGFEDCSSSEATTPVAVQHIRPARVKRRKQSPVPALPIVVQLMEMGFPRRNIEFALKS
LTGASGNASGLPGVEALVGWLLDHSDVQVTELSDADTVSDEYSDEEVVEDMDDAAYSMST
GAVVTESQTYKKRADFLSNDDYAVYVRENIQVGMMVRCCRAYEEVCEGDVGKVIKLDRDG
LHDLNVQCDWQQKGGTYWVRYIHVELIGYPPPSSSSHIKIGDKVRVKASVATPKYKWGSV
THQSVGVVKAFSANGKDIIVDFPQQSHWTGLLSEMELVPSIHPGVTCDGCQMFPINGSRF
KCRNCDDFDFCERSNNTCRACDAFNDRGDFMHHHEIGQSAVFCGRSGKQLKRCHSSQPGM
LLDSWSRMVKSLNVSSSVNQASRLIDGSEPCWQSSGSQGKHWIRLEIFPDVLVHRLKMIV
DPADSSYMPSLVVVSGGNSLNNLIELKTININPSDTAVPLLNDCTEYHRYIEIAIKQCRS
SGIDCKIHGLILLGRIRAEEEDLAAVPFLASDNEEEEDEKGNSGRVSLIRKKAAGLESAA
TIRTKVFVWGLNDKDQLGGLKGSKIKVPSFSETLSALNVVQVAGGSKSLFAVTVEGKVYA
CGEATNGRLGLGISSGTVPIPRQITALSSYVVKKVAVHSGGRHATALTVDGKVFSWGEGD
DGKLGHFSRMNCDKPRLIEALKTKRIRDIACGSSHSAALTSSGELYTWGLGEYGRLGHGD
NTTQLKPKMVKVLLGHRVIQVACGSRDAQTLALTDEGLVFSWGDGDFGKLGRGGSEGCNI
PQNIERLNGQGVCQIECGAQFSLALTKSGVVWTWGKGDYFRLGHGSDVHVRKPQVVEGLR
GKKIVHVAVGALHCLAVTDSGQVYAWGDNDHGQQGNGTTTVNRKPTLVQGLEGQKITRVA
CGSSHSVAWTTVDVATPSVHEPVLFQTARDPLGASYLGVPSDADSSAASNKISGASNSKP
NRPSLAKILLSLDGNLAKQQALSHILTALQIMYARDAIVGALMPAAMIAPVECPSFSSAA
PSDASAMASPMNGEECMLAVDMEDRLSPNPWQEKREIASSEDAVTPSAVTPSAPSASARP
FIPVTDDLGAASIIAETMTKTKEDVESQNKAAGLEPQALDEFTSLLIADDTRVVVDLLKL
SVCSRAGDRGRDVLSAVLSGMGTAYPQVADMLLELCVTELEDVATDSQSGRLSSQPVVVE
SSHPYTDDTSTSGTVKIPGAEGLRVEFDRQCSTERRHDPLTIMDGVNRIVSVRSGREWSD
WSSELRIPGDELKWKFISDGSVNGWGWRFTVYPIMPAAGPKELLSDRCVLSCPSMDLVTC
LLDFRLNLASNRSIVPRLAASLAACAQLSALAASHRMWALQRLRKLLTTEFGQSININRL
LGENDGETRALSFTGSALAALVKGLPEALQRQFEYEDPIVRGGKQLLHSPFFKVLVALAC
DLELDTLPCCAETHKWAWFRRYCMASRVAVALDKRTPLPRLFLDEVAKKIRELMADSENM
DVLHESHDVFKREQDEQLVQWMNRRPDDWTLSAGGSGTIYGWGHNHRGQLGGIEGAKVKV
PTPCEALATLRPVQLIGGEQTLFAVTADGKLYATGYGAGGRLGIGGTESVSTPTLLESIQ
HVFIKKVAVNSGGKHCLALSSEGEVYSWGEAEDGKLGHGNRSPCDRPRVIESLRGIEVVD
VAAGGAHSACVTAAGDLYTWGKGRYGRLGHSDSEDQLKPKLVEALQGHRVVDIACGSGDA
QTLCLTDDDTVWSWGDGDYGKLGRGGSDGCKVPMKIDSLTGLGVVKVECGSQFSVALTKS
GAVYTWGKGDYHRLGHGSDDHVRRPRQVQGLQGKKVIAIATGSLHCVCCTEDGEVYTWGD
NDEGQLGDGTTNAIQRPRLVAALQGKKVNRVACGSAHTLAWSTSKPASAGKLPAQVPMEY
NHLQEIPIIALRNRLLLLHHLSELFCPCIPMFDLEGSLDETGLGPSVGFDTLRGILISQG
KEAAFRKVVQATMVRDRQHGPVVELNRIQVKRSRSKGGLAGPDGTKSVFGQMCAKMSSFG
PDSLLLPHRVWKVKFVGESVDDCGGGYSESIAEICEELQNGLTPLLIVTPNGRDESGANR
DCYLLSPAARAPVHSSMFRFLGVLLGIAIRTGSPLSLNLAEPVWKQLAGMSLTIADLSEV
DKDFIPGLMYIRDNEATSEEFEAMSLPFTVPSASGQDIQLSSKHTHITLDNRAEYVRLAI
NYRLHEFDEQVAAVREGMARVVPVPLLSLFTGYELETMVCGSPDIPLHLLKSVATYKGIE
PSASLIQWFWEVMESFSNTERSLFLRFVWGRTRLPRTIADFRGRDFVIQVLDKYNPPDHF
LPESYTCFFLLKLPRYSCKQVLEEKLKYAIHFCKSIDTDDYARIALTGEPAADDSSDDSD
NEDVDSFASDSTQDYLTGH
Download sequence
Identical sequences ENSPANP00000016171

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]