SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000016184 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPANP00000016184
Domain Number - Region: 31-116
Classification Level Classification E-value
Superfamily t-snare proteins 0.0369
Family t-snare proteins 0.012
Further Details:      
 
Domain Number - Region: 235-287
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0604
Family Spectrin repeat 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000016184   Gene: ENSPANG00000020069   Transcript: ENSPANT00000022202
Sequence length 350
Comment pep:known_by_projection chromosome:PapAnu2.0:9:125067240:125077815:-1 gene:ENSPANG00000020069 transcript:ENSPANT00000022202 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGRSLASKAEPTAGAMDGAEKAEGQDTSSQKIEDLMEMVKKLQKVGSLEPRVEVLINRI
NEAQQAKKKANEDLGEARTICEALQKELDLLHGEKVHLKEILSKKQETLRILRLHCQEKE
SEAQRKHTVLQECKERISALSLQIEEEKNKQRQLRLAFEEQLEELMGQHKDLWDFHRPER
LAREICALDSNKEQLLKEEKLVKATLDDVKHQLCSLCGAEGPSTLDEGLFLRSQEAAATV
QLFQEEHRKAEELLAAAAQSHQQLQQKCQQLQQKRQRLKEELEKRGMQVPAQAQSTQEEE
AGPGEVASPKPLKGERPGAAHRAGPDVLIGQEDTLHPLSPRGFQETKELL
Download sequence
Identical sequences ENSPANP00000016184

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]