SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000016188 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPANP00000016188
Domain Number - Region: 99-196
Classification Level Classification E-value
Superfamily TPR-like 0.00138
Family Tetratricopeptide repeat (TPR) 0.032
Further Details:      
 
Domain Number - Region: 408-445
Classification Level Classification E-value
Superfamily TPR-like 0.0152
Family CT2138-like 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000016188   Gene: ENSPANG00000020043   Transcript: ENSPANT00000012961
Sequence length 570
Comment pep:known_by_projection chromosome:PapAnu2.0:16:67432400:67470797:-1 gene:ENSPANG00000020043 transcript:ENSPANT00000012961 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTLVLQIIKESQQQHGLRHGDFQRYRGYCSRRQRRLRKTLNFKMGNRHKFTGKKVTEEL
LTDNRYLLLVLMDAERAWSYAMQLKQEANTEPRKRFHLLSRLRKAVKHAEELERLCESNR
VDAKTKLEAQAYTAYLSGMLRFEHQEWKAAIEAFNKCKTIYEKLASAFTEEQAVLYNQRV
EEISPNIRYCAYNIGDQSAINELMQMRLRSGGTEGLLAEKLEALITQTRAKQAATMSEVE
WRGRTVPVKIDKVRIFLLGLADNEAAIVQAESEETKERLFESMLSECRDAIQVVREELKP
DQKQRDYILEGESGKVSNLQYLHSYLTYIKLSTAIKRNENMAKGLQRALLQQQPEDDSKR
SPRPQDLIRLYDIILQNLVELLQLPGLEEDKAFQKEIGLKTLVFKAYRCFFIAQSYVLVK
KWSEALVLYDRVLKYANEVNSDAGAFKNSLKDLPDVQELITQVRSEKCSLQAAAILDGND
AHQTETSSSQVKDNKPLVERFETFCLDPSLVTKQANLVHFPPGFQPIPCKPLFFDLALNH
VAFPPLEDKLEQKTKSGLTGYIKGIFGFRS
Download sequence
Identical sequences XP_011718216.1.29376 ENSPANP00000016188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]