SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000016238 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000016238
Domain Number 1 Region: 60-192
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.11e-44
Family Type II thymidine kinase 0.000000503
Further Details:      
 
Domain Number 2 Region: 192-237
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000808
Family Type II thymidine kinase zinc finger 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000016238   Gene: ENSPANG00000019913   Transcript: ENSPANT00000002041
Sequence length 276
Comment pep:known_by_projection chromosome:PapAnu2.0:16:69550667:69564876:-1 gene:ENSPANG00000019913 transcript:ENSPANT00000002041 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RAAGPTRDWPARRGLKRVAREPGTYCGTAVENPWIRELPGGAMSCINLPTVLPGSPSKTR
GQIQVILGPMFSGKSTELMRRVRRFQVAQYKCLVIKYAKDTRYSSSFCTHDRNTMEALPA
CLLRDAAQEALGVAVIGIDEGQFFPDIVEFCEAMANAGKTVIVAALDGTFQRKPFGTILN
LVPLAESVVKLTAVCMECFREAAYTKRLGTEKEVEVIGGADKYHSVCRLCYFKKASGQPA
GPDNKENCPVPGKPGEAVAARKLFAPQQILQCSPAN
Download sequence
Identical sequences A0A0D9S442
ENSPANP00000016238

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]