SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000016305 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000016305
Domain Number 1 Region: 2-238
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 7.59e-84
Family IMD domain 0.000000000771
Further Details:      
 
Domain Number 2 Region: 367-429
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000114
Family SH3-domain 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000016305   Gene: ENSPANG00000019604   Transcript: ENSPANT00000023813
Sequence length 544
Comment pep:known_by_projection chromosome:PapAnu2.0:16:72403363:72482785:1 gene:ENSPANG00000019604 transcript:ENSPANT00000023813 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHRLTENVYKTIMEQFNPSLRNFIAMGKNYEKALAGVTYAAKGYFDALVKMGELASESQG
SKELGDVLFQMAEVHRQIQNQLEEMLKSFHNELLTQLEQKVELDSRYLSAALKKYQTEQR
SKGDALDKCQAELKKLRKKSQGSKNPQKYSDKELQYIDAISNKQGELENYVSDGYKTALT
EERRRFCFLVEKQCAVAKNSAAYHSKGKELLAQKLPLWQQACADPSKIPERAVQLMQQAA
SNGATLPSALSASKSNLVISDPIPGAKPLPVPPELAPFVGRMSAQDSTPIMNGVAGPDGE
DYSPWADRKAAQPKSLSPPQPQSKLSDSYSNTLPVRKSVTPKNSYAATENKTLPRSSSMA
AGLERNGRMRVKAIFSHAAGDNSTLLSFKEGDLITLLVPEARDGWHYGESEKTKMRGWFP
FSYTRVLDSDGSDRLHMSLQQGKSSSTGNLLDKDDLAIPPPDYGAASRAFPAQTTSGFKQ
RPYSVAVPAFSQGLDDYGARSMSRNPFAHVQLKPTVTNDRCDLSTQGPEGREHGDGSAHI
LAGR
Download sequence
Identical sequences ENSPANP00000016305

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]