SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000016306 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000016306
Domain Number 1 Region: 24-374
Classification Level Classification E-value
Superfamily Ras GEF 2.35e-94
Family Ras GEF 0.00041
Further Details:      
 
Domain Number 2 Region: 282-301,370-440
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000113
Family Calmodulin-like 0.036
Further Details:      
 
Domain Number 3 Region: 435-475
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000331
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000016306   Gene: ENSPANG00000019501   Transcript: ENSPANT00000026904
Sequence length 483
Comment pep:known_by_projection chromosome:PapAnu2.0:7:13028676:13049050:-1 gene:ENSPANG00000019501 transcript:ENSPANT00000026904 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESHLISVTEASISLNHSPTYKDALAKNSPGLCLKICYFVRYWITEFWVMFKMDASLTDT
MEEFQELVKAKGEELHCRLIDTTQINARDWSRKLTQRIKSNTSKKRKVSLLFDHLEPEEL
SEHLTYLEFKSFRRISFSDYQNYLVNSCVKENPTMERSIALCNGISQWVQLMVLSRPTPQ
LRAEVFIKFIQVAQKLHQLQNFNTLMAVIGGLCHSSISRLKETSSHVPHEINKVLGEMTE
LLSSSRNYDNYRRAYGECTDFKIPILGVHLKDLISLYEAMPDYLEDGKVNVHKLLALYNH
ISELVQLQEVAPPLEANKDLVHLLTLSLDLYYTEDEIYELSYAREPRNHRAPPLTPSKPP
VVVDWASGVSPKPDPKTISKHVQRMVDSVFKNYDHDQDGYISQEEFEKIAASFPFSFCVM
DKDREGLISRDEITAYFMRASSIYSKLGLGFPHNFQETTYLKPTFCDNCAGFLWGGDQTR
ISM
Download sequence
Identical sequences ENSPANP00000016306

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]