SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000016308 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000016308
Domain Number 1 Region: 955-1169
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.06e-107
Family Thrombospondin C-terminal domain 0.00000000111
Further Details:      
 
Domain Number 2 Region: 29-233
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.72e-39
Family Laminin G-like module 0.00000000463
Further Details:      
 
Domain Number 3 Region: 832-953
Classification Level Classification E-value
Superfamily TSP type-3 repeat 5.1e-37
Family TSP type-3 repeat 0.000000134
Further Details:      
 
Domain Number 4 Region: 489-546
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 2.62e-17
Family TSP-1 type 1 repeat 0.0000133
Further Details:      
 
Domain Number 5 Region: 435-484
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 3.79e-16
Family TSP-1 type 1 repeat 0.0000342
Further Details:      
 
Domain Number 6 Region: 764-834
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.000000000000128
Family TSP type-3 repeat 0.00022
Further Details:      
 
Domain Number 7 Region: 317-374
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000398
Family VWC domain 0.0079
Further Details:      
 
Domain Number 8 Region: 691-775
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.00000000000379
Family TSP type-3 repeat 0.00014
Further Details:      
 
Domain Number 9 Region: 379-428
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000144
Family TSP-1 type 1 repeat 0.0008
Further Details:      
 
Domain Number 10 Region: 547-601
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000176
Family EGF-type module 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000016308   Gene: ENSPANG00000019502   Transcript: ENSPANT00000027006
Sequence length 1170
Comment pep:known_by_projection chromosome:PapAnu2.0:7:14088429:14104120:1 gene:ENSPANG00000019502 transcript:ENSPANT00000027006 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLAWGLGVLFLLHVCGTNRIPESGGDNSVFDIFELTGAARKGSGRRLVKGPDPSSPAFR
IEDANLIPPVPDDKFQDLVDAVRAEKGFLLLASLRQMKKTRGTLLALERKDHSGQVFSVV
SNGKAGTLDLSLTVQGKQHVVSVEEALLATGQWKSITLFVQEDRAQLYIDCEKMENAELD
VPIQSVFTRDLASIARLRIAKGGVNDNFQGVLQNVRFVFGTTPEDILRNKGCSSSTSVLL
TLDNNVVNGSSPAIRTNYIGHKTKDLQAICGISCDELSSMVLELRGLRTIVTTLQDSIRK
VTEENKELVNELRRPPLCYHNGVQYRNNEEWTVDSCTECRCQNSVTICKKVSCPIMPCSN
ATVPDGECCPRCWPSDSADDGWSPWSEWTSCSTSCGNGIQQRGRSCDSLNNRCEGSSVQT
RTCHIQECDKRFKQDGGWSHWSPWSSCSVTCGDGVITRIRLCNSPSPQMNGKPCEGEARE
TKACKKDACPINGGWGPWSPWDICSVTCGGGVQKRSRLCNNPTPQFGGKDCIGDVTENQI
CNKQDCPIDGCLSNPCFAGVKCTSYPDGSWKCGACPPGYSGNGIQCTDVDECKEVPDACF
NHNGEHRCKNTDPGYNCLPCPPRFTGSQPFGQGVEYATANKQVCKPRNPCTDGTHDCNKN
AKCNYLGHYSDPMYRCECKPGYAGNGIICGEDTDLDGWPNEDLVCVANATYHCKKDNCPN
LPNSGQEDYDKDGIGDACDDDDDNDKIPDDRDNCPFHYNPAQYDYDRDDVGDRCDNCPYN
HNPDQADTDSNGEGDACAADIDGDGILNERDNCQYVYNVDQRDTDMDGVGDQCDNCPLEH
NPDQLDSDSDRIGDTCDNNQDIDEDGHQNNLDNCPYVPNANQADHDKDGKGDACDHDDDN
DGIPDDRDNCRLVPNPDQKDSDGDGRGDACKDDFDHDNVPDIDDICPENVDISETDFRRF
QMIPLDPKGTSQNDPNWVVRHQGKELVQTVNCDPGLAVGYDEFNAVDFSGTFFINTERDD
DYAGFVFGYQSSSRFYVVMWKQVTQSYWDTNPTRAQGYSGLSVKVVNSTTGPGEHLRNAL
WHTGNTPGQVRTLWHDPRHIGWKDFTAYRWRLSHRPKTGFIRVVMYEGKKIMADSGPIYD
KTYAGGRLGLFVFSQEMVFFSDLKYECRDP
Download sequence
Identical sequences A0A096NTD7
ENSPANP00000016308

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]