SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000016326 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000016326
Domain Number 1 Region: 312-663
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 8.58e-130
Family Mammalian PLC 0.00000000000624
Further Details:      
 
Domain Number 2 Region: 877-938,975-1151
Classification Level Classification E-value
Superfamily C-terminal domain of PLC-beta 1.1e-70
Family C-terminal domain of PLC-beta 0.000000409
Further Details:      
 
Domain Number 3 Region: 143-308
Classification Level Classification E-value
Superfamily EF-hand 7.48e-49
Family EF-hand modules in multidomain proteins 0.0000000293
Further Details:      
 
Domain Number 4 Region: 12-141
Classification Level Classification E-value
Superfamily PH domain-like 3.63e-44
Family Pleckstrin-homology domain (PH domain) 0.000000164
Further Details:      
 
Domain Number 5 Region: 683-800
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.16e-23
Family PLC-like (P variant) 0.00000146
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000016326   Gene: ENSPANG00000019485   Transcript: ENSPANT00000018829
Sequence length 1185
Comment pep:known_by_projection chromosome:PapAnu2.0:7:14796822:14820502:-1 gene:ENSPANG00000019485 transcript:ENSPANT00000018829 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLLNPVLLPPRVKAYLSQGERFIKWDDETTIASPVILRVDPKGYYLYWTYQSKEMEFLD
ITSIRDTRFGKFAKMPKSQKLRDVFNMDFPDNSFLLKTLTVVSGPDMVDLTFHNFVSYKE
NVGKVWAEDILALVKHPLTANASRSTFLDKILVKLKMQLNSEGKIPVKNFFQMFPADRKR
VEAALSACHLPKGKNDAINPEDFPEPVYKSFLMSLCPRPEIDEIFTSYHAKAKPYMTKEH
LTKFINQKQRDSRLNSLLFPPARPDQVQGLIDKYEPSGINVQRGQLSPEGMVWFLCGPEN
SVLAQDKLLLHHDMTQPLNHYFINSSHNTYLTAGQFSGLSSAEMYRQVLLSGCRCVELDC
WKGKPPDEEPIITHGFTMTTDIFFKEAIEAIAESAFKTSPYPIILSFENHVDSPRQQAKM
AEYCRTIFGDMLLTEPLEKFPLKPGVPLPSPEDLRGKILIKNKKNQFSSPTSSSKDPGGE
AEGSSPRSAPAGEGTVWAGEEGTELEDEEVEEEEEEESGNLDEEEIKKMQSDEGTAGLEV
TAYEEMSSLVNYIQPTKFISFEFSAQKNRSYVISSFTELKAYDLLSKASVQFVDYNKRQM
SRIYPKGTRMDSSNYMPQMFWNAGCQMVALNFQTMDLPMQQNMAVFEFNGQSGYLLKHEF
MRRPDKQFNPFSVDRIDVVVATTLSITVISGQFLSERSVRTYVEVELFGLPGDPKRRYRT
KLSPSTNSINPVWKEEPFVFEKILMPELASLRVAVMEEGNKFLGHRIIPINALNSGYHHL
CLHSESNMPLTMPALFVFLEMKDYVPGAWADLTVALANPIKFFNAHDKRSVKLKEVMGGL
PEKPFPLASPVASQVNGALAPKSNGSPAAKAWAREEAMKEVAEPRTASLEELRELKGVVK
LQRRHEKELRELERRGARRWEELLQRGAAQLAELGPRGAGGGGAGKLGPGKGSRKKRSLP
CEESAGTAPGESPEGMDARVRELKDRLELELLRQGEEQYECVLKRKEQHAAEQISKMMEL
AREKQAAELKALKETAEIDTKEMKKKLETKRLERIQGMTKVTADKMAQERLKREINNSHI
QEVVQVIKQMTENLEKHQEKLEEKQAACLEQIREMEKQFQKEALAEYEARMKGLEAEVKE
SVRACFRTCFPSETKDKPERDCECPRELCEQDPVVAKTDVQESHL
Download sequence
Identical sequences ENSPANP00000016326

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]