SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000016353 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000016353
Domain Number 1 Region: 307-437
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000949
Family Tetratricopeptide repeat (TPR) 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000016353   Gene: ENSPANG00000019333   Transcript: ENSPANT00000012958
Sequence length 467
Comment pep:known_by_projection chromosome:PapAnu2.0:7:15276943:15298836:-1 gene:ENSPANG00000019333 transcript:ENSPANT00000012958 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRLGALGGARAGLGLLLGTAAGLGFLCLLYSQRWKRTQRHGRSQSLPNSLDYTQTSETG
RQVMLLRAVSGGAGDAAVLPSLPREGQEKVLDRLDFVLTSLVALRREVEELRSSLRGLAG
EIVGEVRSHMEENQRVARRRRFPFVRERSDSTGSSSVYFTASSGATFTDAESEGGYTTAN
AESDNERDSDKESEDGEDEVSCETVKMGRKDSLDLEEEAASGVVPSALEAGGSSGLEDVL
PLLQQADELHRGDEQGKREGFQLLLNNKLAYGSRQDFLWRLARAYSDMCELTEEVSEKKS
YALDGKEEAEAALEKGDESADCHLWYAVLCGQLAEHESIQRRIQSGFSFKEHVDKAIALQ
PENPMAHFLLGRWCYQVSHLSWLATALLESPLSATVEDALQSFLKAEELQPGFSKAGRVY
ISKCYRELGKNSEARWWMKLALELPDVTKEDLALQKDLEELEVTLGD
Download sequence
Identical sequences ENSPANP00000016353

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]