SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000016359 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000016359
Domain Number 1 Region: 375-425
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 1.83e-19
Family B-box zinc-binding domain 0.0000678
Further Details:      
 
Domain Number 2 Region: 56-107
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000213
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000016359   Gene: ENSPANG00000019317   Transcript: ENSPANT00000024077
Sequence length 428
Comment pep:known_by_projection chromosome:PapAnu2.0:7:15362439:15368027:1 gene:ENSPANG00000019317 transcript:ENSPANT00000024077 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGILYKPSFGLNKMLETEELLYSPPLGLRGPTPLPPSSSXXXXXXXXXXXXXXXXXCGRA
FCSGCLSFSAAVPRTGNTQQKVCKQCHEVLTRGSSANASKWSPPQNYKKRVAALEAKQKP
STSQSQGLTRQDQMIAERLARLRQENKPKLVPSQEEIEARLAALKDERQGSIPSTREMEA
RLAALQGRVLPSQTPQPAHHTPDNRTQAQQTQDLLTQLAAEVAIDSWKGGGPAASLQNDL
NQGGPGSTHSKKQASWSLEEEKSRLLAEAALELREENTRQERILALAKRLAVLRGQDPER
VTLQDYRLPDSDDDEDEETAIQRVLQQLTEEAALDEASGFNIPAEQASRPRTQPRRTQPE
AQDVDPRPEAEEEELPWCCICNEDATLRCAGCDGDLFCARCFREGHDAFELKEHHTSAYS
PPRAGREH
Download sequence
Identical sequences ENSPANP00000016359

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]