SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000016364 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000016364
Domain Number 1 Region: 26-139
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.98e-35
Family PDI-like 0.00000596
Further Details:      
 
Domain Number 2 Region: 371-476
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.76e-32
Family PDI-like 0.00094
Further Details:      
 
Domain Number 3 Region: 235-369
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.53e-27
Family PDI-like 0.028
Further Details:      
 
Domain Number 4 Region: 146-248
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.35e-24
Family PDI-like 0.00000613
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000016364   Gene: ENSPANG00000019308   Transcript: ENSPANT00000023290
Sequence length 512
Comment pep:known_by_projection chromosome:PapAnu2.0:16:73166815:73189259:-1 gene:ENSPANG00000019308 transcript:ENSPANT00000023290 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRRALLCLAVAAAARVYADAPEEEDHVLVLRKSNFAEALAAHKYLLVEFYAPWCGHCKA
LAPEYAKAAGKLKAEGSEIRLAKVDATEESDLAQQYGVRGYPTIKFFRNGDTASPKEYTG
LAGREADDIVNWLKKRTGPAATTLPDGAAAESLVESSEVAVIGFFKDVESDSAKQFLQAA
EAIDDIPFGITSNSDVFSKYQLDKDGVVLFKKFDEGRNNFEGEVTKENLLDFIKYNQLPL
VIEFTEQTAPKIFGGEIKTHILLFLPKSVSDYDGKLSNFKTAAESFKGKILFIFIDSDHT
DNQRILEFFGLKKEECPAVRLITLEEEMTKYKPESDELTAERITEFCHRFLEGKIKPHLM
SQELPEDWDKQPVKVLVGKNFEEVAFDENKNVFVEFYAPWCGHCKQLAPIWDKLGETYKD
HENIVIAKMDSTANEVEAVKVHSFPTLKFFPASVDRTVIDYNGERTLDGFKKFLESGGQD
GAGDDDDLEDLEEAEEPDMEEDDDQKAVKDEL
Download sequence
Identical sequences ENSPANP00000016364

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]