SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000016365 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000016365
Domain Number 1 Region: 7-204
Classification Level Classification E-value
Superfamily E set domains 6.72e-82
Family RhoGDI-like 0.00000000414
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000016365   Gene: ENSPANG00000019264   Transcript: ENSPANT00000007975
Sequence length 204
Comment pep:known_by_projection chromosome:PapAnu2.0:16:73199762:73200826:-1 gene:ENSPANG00000019264 transcript:ENSPANT00000007975 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEQEPTAEQLAQIAAENEEDEHSVNYKPPAQKSIQEIQELDKDDESLRKYKEALLGRVA
VSADPNVPNVVVTGLTLVCSSAPGPLELDLTGDLESFKKQSFVLKEGVEYRIKISFRVNR
EIVSGMKYIQHTYRKGVKIDKTDYMVGSYGPRAEEYEFLTPVEEAPKGMLARGSYSIKSR
FTDDDKTDHLSWEWNLTIKKDWKD
Download sequence
Identical sequences A0A2K5P436 A0A2K5XAP7 A0A2K6CYX6 A0A2K6LC14 A0A2K6PXA7 G2HHW3 G3R7E2 G7PT55 H2NV28 P52565 Q4R4J0 V9HWE8
9598.ENSPTRP00000016637 9600.ENSPPYP00000009819 9606.ENSP00000269321 ENSGGOP00000011277 ENSPPYP00000009819 1hh4D ENSP00000269321 ENSP00000441348 ENSP00000464205 ENSGGOP00000011277 ENSPANP00000016365 cath|current|1hh4D00/309-501 gi|297374782|ref|NP_001172006.1| gi|4757768|ref|NP_004300.1| NP_001172006.1.87134 NP_001172006.1.92137 NP_001233363.1.37143 NP_001270796.1.63531 NP_004300.1.87134 NP_004300.1.92137 XP_002828003.1.23681 XP_003831157.1.60992 XP_004040820.1.27298 XP_008011470.1.81039 XP_008011471.1.81039 XP_009250445.1.23681 XP_010352612.1.97406 XP_011718520.1.29376 XP_011817575.1.43180 XP_011817636.1.43180 XP_011851166.1.47321 XP_011921506.1.92194 XP_014976087.1.72884 XP_016786049.1.37143 XP_017721923.1.44346 XP_018882949.1.27298 1cc0_E 1cc0_F 1hh4_D 1hh4_E ENSPTRP00000016637 Hs4757768___KOG3205 ENSPTRP00000016637 ENSPPYP00000009819 ENSP00000269321 ENSP00000441348 ENSP00000464205

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]