SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000016389 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000016389
Domain Number 1 Region: 23-179
Classification Level Classification E-value
Superfamily EF-hand 2.78e-48
Family SCOPe 0.0000827
Further Details:      
 
Domain Number 2 Region: 66-178
Classification Level Classification E-value
Superfamily CATH 0.00000000000000258
Family CATH 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000016389   Gene: ENSPANG00000019002   Transcript: ENSPANT00000002085
Sequence length 195
Comment pep:known_by_projection chromosome:PapAnu2.0:7:15786106:15834529:1 gene:ENSPANG00000019002 transcript:ENSPANT00000002085 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSRASTLLRDEELEEIKKETGFSHSQITRLYSRFTSLDKGENGTLSREDFQRIPELAIN
PLGDRIINAFFPEGEDQVNFRGFMRTLAHFRPIEDNEKSKDVNGPEPLNSRSNKLHFAFR
LYDLDKDEKISRDELLQVLRMMVGVNISDEQLGSIADRTIQEADQDGDSAISFTEFVKVL
EKVDVEQKMSIRFLH
Download sequence
Identical sequences A0A024R9M9 A0A096NTL8 A0A0D9R5N7 A0A1D5R6I4 A0A2I2ZWL9 A0A2J8S5V4 A0A2K5MT51 A0A2K5V2N0 A0A2K5ZRK2 A0A2K6C2R3 A0A2K6NGD5 G1QTE6 H2Q976 Q5R7F0 Q99653
ENSPTRP00000011844 ENSMMUP00000022485 ENSNLEP00000004214 d2e30a_ 2e30_A gi|6005731|ref|NP_009167.1| 9544.ENSMMUP00000022485 9598.ENSPTRP00000011844 9606.ENSP00000335632 ENSPTRP00000011844 ENSP00000335632 NP_001127537.1.23681 NP_001253300.1.72884 NP_009167.1.87134 NP_009167.1.92137 XP_003266795.1.23891 XP_003826656.1.60992 XP_005559290.1.63531 XP_008015135.1.81039 XP_009248007.1.23681 XP_010367344.1.97406 XP_011757102.1.29376 XP_011844698.1.47321 XP_011890223.1.92194 XP_018866726.1.27298 XP_523056.2.37143 ENSNLEP00000004214 ENSMMUP00000022485 CBPP22 ENSPANP00000016389 ENSP00000335632 ENSP00000335632

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]