SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000016393 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000016393
Domain Number 1 Region: 351-430
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000000103
Family C-terminal fragment of elongation factor SelB 0.073
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000016393
Domain Number - Region: 163-269
Classification Level Classification E-value
Superfamily TPR-like 0.00607
Family Tetratricopeptide repeat (TPR) 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000016393   Gene: ENSPANG00000018999   Transcript: ENSPANT00000024865
Sequence length 487
Comment pep:known_by_projection chromosome:PapAnu2.0:16:73415347:73425434:1 gene:ENSPANG00000018999 transcript:ENSPANT00000024865 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLPVQVFNLQGAVEPMQIDVDPQEDPQNAPDVNYVVENPSLDLEQYAASYSGLMRIERL
QFIADHCPTLRVEALKMALSFVQRTFNVDMYEEIHRKLSEATRELQNAPDAIPESGVEPP
PLDTAWVEATRKKALLKLEKLDTDLKNYKGNSIKESIRRGHDDLGDHYLDCGDLSNALKC
YSRARDYCTSAKHVINMCLNVIKVSVYLQNWSHVLSYVSKAESTPEIAEQRGERDSQTQA
ILTKLKCAAGLAELAARKYKQAAKCLLLASFDHCDFPELLSPSNVAIYGGLCALATFDRQ
ELQRNVISSSSFKLFLELEPQVRDIIFKFYESKYASCLKMLDEMKDNLLLDMYLAPHVRT
LYTQIRNRALIQYFSPYVSADMHRMAAAFNTTVAALEDELTQLILEGLISARVDSHSKIL
YARDVDQRSTTFEKSLLMGKEFQRRAKAMMLRAAVLRNQIHVKSPPREGSQGELTPANSQ
SRMSTNM
Download sequence
Identical sequences A0A2K6DTJ8
XP_008011515.1.81039 XP_011718556.1.29376 XP_011921452.1.92194 ENSPANP00000016393

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]