SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000016395 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000016395
Domain Number 1 Region: 2-355,385-405
Classification Level Classification E-value
Superfamily Thiolase-like 4.81e-75
Family Thiolase-related 0.0021
Further Details:      
 
Domain Number 2 Region: 2224-2500
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 1.82e-64
Family Thioesterase domain of polypeptide, polyketide and fatty acid synthases 0.000000000131
Further Details:      
 
Domain Number 3 Region: 1639-1797
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 1.05e-41
Family Alcohol dehydrogenase-like, C-terminal domain 0.0000814
Further Details:      
 
Domain Number 4 Region: 492-617,680-776
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 9.94e-40
Family FabD-like 0.0057
Further Details:      
 
Domain Number 5 Region: 1884-2072
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 1.5e-33
Family Tyrosine-dependent oxidoreductases 0.00023
Further Details:      
 
Domain Number 6 Region: 1217-1402
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 1.83e-17
Family UbiE/COQ5-like 0.031
Further Details:      
 
Domain Number 7 Region: 1558-1674
Classification Level Classification E-value
Superfamily GroES-like 5.76e-16
Family Alcohol dehydrogenase-like, N-terminal domain 0.0073
Further Details:      
 
Domain Number 8 Region: 2122-2187
Classification Level Classification E-value
Superfamily ACP-like 0.00000000000301
Family Acyl-carrier protein (ACP) 0.00019
Further Details:      
 
Domain Number 9 Region: 617-673
Classification Level Classification E-value
Superfamily Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.00000000902
Family Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000016395   Gene: ENSPANG00000018946   Transcript: ENSPANT00000028150
Sequence length 2510
Comment pep:known_by_projection chromosome:PapAnu2.0:16:73442538:73466544:-1 gene:ENSPANG00000018946 transcript:ENSPANT00000028150 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEVVIAGMSGKLPESENLQEFWDNLIGGVDMVTDDDRRWKAGLYGLPRRSGKLKDLSRF
DASFFGVHPKQAHTMDPQLRLLLEVTYEAIVDAGINPASLRGTHTGVWVGVSGSEASEAL
SRDPETLVGYSMVGCQRAMMANRLSFFFDFKGPSIALDTACSSSMVALQSAYQAISSGQC
PAAIVGGINVLLKPNTSVQFLRLGMLSPEGTCKAFDAEGNGYCRSEGVVAVLLTKKSLAR
RVYATILNAGTNTDGCKEQGVTFPSGEAQEQLIRSLYQSAGVAPESFEYIEAHGTGTKVG
DPQELNGIARALCATRQEPLLVGSTKSNMGHPEPVSGLAALAKVLLSLEHGLWAPNLHFH
SPHPEIPALLDGRLQVVAQPLPVRGGNVGINSFGFGGSNVHVILRPHTQPPPAPAPHASL
PRLLRASGRTPEAVQELLEQGLQHSQELAFLSMLNDIAAIPTTAMPFRGYAVLGGEHGGP
EVQQVPAGERPLWFICSGMGTQWRGMGLSLMRLDRFRDSILRSDEAVKPFGLKVSQLLLS
MDESTFDDIVHAFVSLTAIQIGLIDLLSCMGLRPDGIIGHSLGEVACGYADGCLSQEEAV
LAAYWRGQCIKEAHLPPGAMAAVGLSWEECKQRCPPGVVPACHNSKDTVTISGPQASVLE
FMEQLRKEGVFAKEVRTGGMAFHSYFMEAIAPPLLQALKKVIREPKPRSARWLSTSIPEA
QWHSSLARTSSAEYNVNNLVSPVLFQEALCHVPEHAVVLEIAPHALLQAVLKRGLKPGCT
IIPLMKKDHRDNLEFFLTGIGRLHLSGIDANPNALFPPVEFPAPRGTPLISPLIKWDHSL
AWDVPAAEDFPNGSGSSSAAVYNIDTSPESPDHYLVDHTIDGRVIFPATGYLCIVWKTLA
RALGLAVEQLPVVFEDVVLHQATILPKTGTVSLEVRLLEASRAFEVSQNGNLIVSGKVYQ
WEDPDPRLFNHPESPTPNPEEPLFLTQAEVYKELRLRGYDYGPHFHGILEASLEGESGRL
LWKDNWVSFLDAMLQTSILGLAKRSLHLPTRITAIHIDPATHRQKLYTLQDDAQVADVVV
SRWLSITVAGGVHMSRVHTESAPRRQQDQQVPILEKFCFTPHVEEGCLSERAALQKELQL
CKGLAQALQTKVTQQGLRMVVPGLDGAQVPQDPLQQGLPQLLSAACRLQLNGNLQLELAQ
VLAQKRPELSEDPLLSGLLDSPALRACLDTAVENMPSRKMKVVEVLAGHGHLYSRIPGLL
GAQPLLQLSYTATDRHPQALEAAEAQLQQHDIAQGQWDPADPAPSTLGSTDLLVCNCAVA
ALGDPASALSNMVATLREGGFLLLHTLLRGHPLGETVAFLTSAEPQYGQGILSQDAWESL
FSSVSLRLVGLKKSFYGSALFLCRRPAPQDSPIFLPVDDTSFRWVESLKGILADEDSSRP
VWLKAVNCATSGVVGLVNCLRQEPGGHRLRCVLLSNLSSTSRVPEVDPGSAELQKVLQGD
LVMNVYRDGAWGAFRHFLLEEDKPEEPTAHAFVTTLTRGDLSSIRWVCSSLRHAQPSRPG
AQLCTVYYASLNFRDIMLATGKLSPEAIPGKWASQDNLLGMEFSGRDPSGKRVMGLVPAE
GLATSVLLSPDFLWDVPSNWTLEEAASVPVVYCTAYYSLVVRGRVRPGETVLIHSGSGGV
GQAAIAIALSLGCRVFTTVGSSEKRAYLQARFPQLDSTSFANSRDTSFEQHVLRHTGGKG
VDLVLNSLAEEKLQASVRCLAQHGRFLEIGKFDLSQNHPLGMAIFLKNVTFHGILLDALL
DGSAEWQEVAALLQAGIRDGVVQPLKCTVFPGAQVEDAFRYMAQGKHIGKVLVQVLAEEP
EAVLKGAKPTLMSAISKTFCPAYKSYIIAGGLGGLGLELAQWLIQRGAQKLVLTSRSGVR
TGYQAKQVRQWRRQGVQVLVSTSNISSLEGARGLIAEAAQLGPVGGIFNLTMVLRDAMLE
NQTPEFFQDVCKPKYSGTLNLDRVTREACPELDYFVVFSSVSSGRGNAGQSNYGFANSAM
ERICEKRRHEGLPGLAVQWGAIGDVGILADTVNINATVIGGTLPQRVASCLEVLDLFLNQ
PHMVLSSFVLAEKAAAYRDRDSEQDLVKAVAHILGIRDLAAINLDSSLADLGLDSLMSVE
VRQTLERELNLVLSMREVRQLTLRRLQELSLKADAASELASPTPKEDGLARQQTQLNLRS
LLVNPEGPTLMRLNSVQSSERPLFLVHPIEGSTTVFHSLASRLSIPTYGLQCTRAAPLDS
IHSLAAYYIDCIRQVQPEGPYRVAGYSYGACVAFEMCSQLQAQQNPAPTHNSLFLFDGSH
TYVLAYTQSYRAKLTPGCEAEAETEAICFFVQQFTDMEHNRVLEALLPLKGLEERVAAAV
DLIIKSHQGLDRQELSFAALSFYYKLRAAEQYTPKAKYHGNVMLLRAKTGGAYGEDLGAD
YNLSQVCDGKVSVHVIEGDHRTLLEGSGLESIVSIIHSSLAEPRVSVREG
Download sequence
Identical sequences A0A096NTM4
ENSPANP00000016395

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]