SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000016429 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000016429
Domain Number 1 Region: 56-324
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.14e-29
Family G proteins 0.03
Further Details:      
 
Domain Number 2 Region: 445-534
Classification Level Classification E-value
Superfamily EF-hand 7.14e-22
Family Eps15 homology domain (EH domain) 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000016429   Gene: ENSPANG00000018707   Transcript: ENSPANT00000026633
Sequence length 541
Comment pep:known_by_projection chromosome:PapAnu2.0:7:16488541:16560529:-1 gene:ENSPANG00000018707 transcript:ENSPANT00000026633 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSWMGRQAGGRERAGGVDAVQTVTGGLRSLYLRKVLPLEEAYRFHEFHSPALEDADFEN
KPMILLVGQYSTGKTTFIRYLLEQDFPGMRIGPEPTTDSFIAVMYGETEGSTPGNALVVD
PKKPFRKLSRFGNAFLNRFMCSQLPNQVLKSISIIDSPGILSGEKQRISRGYDFCQVLQW
FAERVDRIILLFDAHKLDISDEFSEAIKAFRGQDDKIRVVLNKADQVDTQQLMRVYGALM
WSLGKVINTPEVLRVYIGSFWAQPLQNTDNRRLFEAEAQDLFRDIQSLPQKAAVRKLNDL
IKRARLAKVHAYIISYLKKEMPSVFGKENKKRELISRLPEIYIQLQREYQISAGDFPEVK
AMQEQLENYDFTKFHSLKPKLIEAVDNMLSNKISPLMNLISQEEMSTPTQLVQGGAFDGT
TEGPFNQGYGEGAKEGADEEEWVVAKDKPVYDELFYTLSPINGKISGVNAKKEMVTSKLP
NSVLGKIWKLADCDCDGMLDEEEFALAKHLIKIKLDGYELPSSLPPHLVPPSHRKSLPKA
D
Download sequence
Identical sequences A0A096NTQ8 A0A2K5M6Z6 A0A2K5W1H8 A0A2K6BWK2 F7HAE5
ENSMMUP00000005127 ENSMMUP00000005127 ENSPANP00000016429 9544.ENSMMUP00000005127 NP_001245064.1.72884 XP_005559332.1.63531 XP_011756747.1.29376 XP_011890290.1.92194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]