SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000016435 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000016435
Domain Number 1 Region: 313-669
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 2.67e-100
Family Lysophospholipase 0.00000412
Further Details:      
 
Domain Number 2 Region: 42-160
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.83e-23
Family PLC-like (P variant) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000016435   Gene: ENSPANG00000018640   Transcript: ENSPANT00000024863
Sequence length 698
Comment pep:known_by_projection chromosome:PapAnu2.0:7:16723881:16736773:-1 gene:ENSPANG00000018640 transcript:ENSPANT00000024863 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLWALWPRWLAGKMLPLLGAVLLQKRENRGPLWRHWRRETHPYYDLQVKVLRATNIRDTD
LLSKADCYVQLWLPTASPSPAQTRTVANCSDPEWNETFHYQIHDAVKNVLELTLYDKDIL
LSDQHSQLLFDLRSLKCGQPHRHTFPLNQQDSQELQVEFVLEKSQVPASEVITNGVLVAH
PCLRIQGTLRGDGTAPREEYGSRQLQLTVPGAYEKPQLLPLQPPTEPGLQPTFTFHVNPV
LSSRLHVELMEQLSAVQSDPSAELEAQTSKLGEGGILLSSLPLGQEEQCSVALGEGQEVA
LSVKVEMSSGDLDLRLGFDLCDGEQEFLDRRKQVVAKALQQVLGLSEAPDSGQVPVVAVL
GSGGGTRAMSSLYGSLAGLQELGLLDTVTYLSGVSGSTWCISTLYRDPAWSQVALQGPIE
RAQVHVCSSKMGALSTERLQYYAQELGVRKRSGHSVSPVDLWGLFVEYFLYQEENPAKLS
DQQEAVRQGQNPYPIYTSVNVRTDMSGEDFAEWCEFTPYEVGFPKYGAYVPTEVFGSELF
MGRLLQLQPEPRICYLQGMWGSAFATSLDEIVLKTAGSGLGFLECYRGSVNITDDCQKPQ
PHNPSRLRTRILTPQGPFSQAVLDIFTSRFTSAQSFNFTRGLCLHKDYVAGREFVAWKGE
CCPGWEMGASLPACASGSLGRVLALGWGLRCGLLLPMG
Download sequence
Identical sequences ENSPANP00000016435

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]