SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000016445 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000016445
Domain Number 1 Region: 722-779
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5.98e-17
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 2 Region: 27-69
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000000275
Family Somatomedin B domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000016445   Gene: ENSPANG00000020710   Transcript: ENSPANT00000026472
Sequence length 821
Comment pep:known_by_projection scaffold:PapAnu2.0:JH685040.1:94664:103424:-1 gene:ENSPANG00000020710 transcript:ENSPANT00000026472 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SGPGLALDWPLLTGDGEGPASSPPDAQDSCSMRCGALDGPCSCHPTCSGLGTCCLDFRDF
CLEILPYSGSMMGGKDFVVQHFKMSSPTDTSAICRFKESIQTLGHVDSSGQVHCVSPLLY
ESGRVPFTVSLDNGHSFPRAGTWLAVHPNKVSMMEKSELVNETRWQYYGTADTSGNLSLT
WHVEALPTQTVTIELWGYEETGMPYSQEWTAKWSYLYPLATHIPNSGSFTFTPKPAPPSY
QRWRVGALRIIDSKNYAGQKDVQALWTNDHALAWHLSDDFREDPVAWARTQCQAWEELED
QLPSFLEELPDCPCTLTQARADSGRFFTDYGCDMEQGSVCTYHPGAVHCVRSVQASPRYG
SGQQCCYTADGTQLLTADSSSGSTPDRGHDWGAPPFRTPPRVPGMSHWLYDVLSFYYCCL
WAPDCPRYMQRRPSNDCRNYRPPRLASAFGDPHFVTFDGTNFTFNGRGEYVLLEAVLTDL
RVQARAQPGRMSNGTQTRGTGLTAMAVQEGNSDVVEVRLANGTRGLEVLLNQEVLSFAEQ
SWMDLKGMFLSVAARDRVSIMLASGAGLEVSVQGPFLSVSVLLPEKFLTHTHGLLGTLNN
DPTDDFTLRSGRVLPLSSSPRELFLFGADWAVHNASSLLTYDSWFLVHNFLYQPKHDPTF
EPLFAGETTLNPSQAQEAAKLCGDDHFCNFDVAATGSLSTGNATRVAHQLHQRRMWSLQP
VVSCGWLAPPPNGQKEGNRYLAGSTIYFHCDNGYSLAGAETSTCQADGTWSSPTPECQPG
RSYAVLLGIIFGGLAVVAAVALVYVLLRRRKGNMHIWGTQP
Download sequence
Identical sequences ENSPANP00000016445

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]